CDKN3 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-92881

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-69 of human CDKN3 (NP_005183.2). MKPPSSIQTSEFDSSDEEPIEDEQTPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEELKS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CDKN3 Antibody - Azide and BSA Free

CDKN3 Antibody - Azide and BSA Free

Western Blot: CDKN3 Antibody - Azide and BSA Free [NBP2-92881] -

Western Blot: CDKN3 Antibody - Azide and BSA Free [NBP2-92881] - Western blot analysis of lysates from Mouse liver using CDKN3 Rabbit pAb at 1:2000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit.
Exposuretime:60s.
CDKN3 Antibody - Azide and BSA Free

Western Blot: CDKN3 Antibody - Azide and BSA Free [NBP2-92881] -

Western Blot: CDKN3 Antibody - Azide and BSA Free [NBP2-92881] - Western blot analysis of lysates from MCF7 cells, using CDKN3 Rabbit pAb at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
CDKN3 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: CDKN3 Antibody - Azide and BSA Free [NBP2-92881] -

Immunocytochemistry/ Immunofluorescence: CDKN3 Antibody - Azide and BSA Free [NBP2-92881] - Immunofluorescence analysis of MCF7 cells using CDKN3 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for CDKN3 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50-1:200

Western Blot

1:100 - 1:500

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CDKN3

CDKN3 is encoded by this gene belongs to the dual specificity protein phosphatase family. It was identified as a cyclin-dependent kinase inhibitor, and has been shown to interact with, and dephosphorylate CDK2 kinase, thus prevent the activation of CDK2 kinase. This gene was reported to be deleted, mutated, or overexpressed in several kinds of cancers.

Alternate Names

CDI1KAP1, CDK2-associated dual specificity phosphatase, CDK2-associated dual-specificity phosphatase, Cdk-associated protein phosphatase, CIP2, cyclin-dependent kinase inhibitor 3, cyclin-dependent kinase interacting protein 2, Cyclin-dependent kinase interactor 1, Cyclin-dependent kinase-interacting protein 2, EC 3.1.3.16, EC 3.1.3.48, FLJ25787, KAPMGC70625, Kinase-associated phosphatase

Gene Symbol

CDKN3

Additional CDKN3 Products

Product Documents for CDKN3 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CDKN3 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CDKN3 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review CDKN3 Antibody - Azide and BSA Free and earn rewards!

Have you used CDKN3 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...