CDNF Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88994

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CDNF Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: TLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATH

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (85%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CDNF Antibody - BSA Free

Western Blot: CDNF Antibody [NBP1-88994]

Western Blot: CDNF Antibody [NBP1-88994]

Western Blot: CDNF Antibody [NBP1-88994] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue
Immunohistochemistry-Paraffin: CDNF Antibody [NBP1-88994]

Immunohistochemistry-Paraffin: CDNF Antibody [NBP1-88994]

Immunohistochemistry-Paraffin: CDNF Antibody [NBP1-88994] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: CDNF Antibody [NBP1-88994]

Immunohistochemistry-Paraffin: CDNF Antibody [NBP1-88994]

Immunohistochemistry-Paraffin: CDNF Antibody [NBP1-88994] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: CDNF Antibody [NBP1-88994]

Immunohistochemistry-Paraffin: CDNF Antibody [NBP1-88994]

Immunohistochemistry-Paraffin: CDNF Antibody [NBP1-88994] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: CDNF Antibody [NBP1-88994]

Immunohistochemistry-Paraffin: CDNF Antibody [NBP1-88994]

Immunohistochemistry-Paraffin: CDNF Antibody [NBP1-88994] - Staining of human skeletal muscle shows moderate to strong cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: CDNF Antibody [NBP1-88994]

Immunohistochemistry-Paraffin: CDNF Antibody [NBP1-88994]

Immunohistochemistry-Paraffin: CDNF Antibody [NBP1-88994] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Applications for CDNF Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CDNF

Trophic factor for dopamine neurons. Prevents the 6-hydroxydopamine (6-OHDA)-induced degeneration ofdopaminergic neurons. When administered after 6-OHDA-lesioning, restores the dopaminergic function and prevents thedegeneration of dopaminergic neurons in substantia nigra

Long Name

Conserved Dopamine Neurotrophic Factor

Alternate Names

ARMETL1

Gene Symbol

CDNF

Additional CDNF Products

Product Documents for CDNF Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CDNF Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CDNF Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CDNF Antibody - BSA Free and earn rewards!

Have you used CDNF Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies