Recombinant Human CDR2 GST (N-Term) Protein

Novus Biologicals | Catalog # H00001039-P01

Novus Biologicals
Loading...

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Microarray
Loading...

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-454 of Human CDR2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQQMYTTNQEQLQEIEYLTKQVELLRQMNEQHAKVYEQLDVTARELEETNQKLVADSKASQQKILSLTETIECLQTNIDHLQSQVEELKSSGQGRRSPGKCDQEKPAPSFACLKELYDLRQHFVYDHVFAEKITSLQGQPSPDEEENEHLKKTVTMLQAQLSLERQKRVTMEEEYGLVLKENSELEQQLGATGAYRARALELEAEVAEMRQMLQSEHPFVNGVEKLVPDSLYVPFKEPSQSLLEEMFLTVPESHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVDTQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGVNAQSEPVASGWELASVNPEPVSSPTTPPEYKALFKEIFSCIKKTKQEIDEQRTKYRSLSSHS

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

75.68 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human CDR2 GST (N-Term) Protein

SDS-PAGE: Recombinant Human CDR2 GST (N-Term) Protein [H00001039-P01]

SDS-PAGE: Recombinant Human CDR2 GST (N-Term) Protein [H00001039-P01]

SDS-Page: Recombinant Human CDR2 Protein [H00001039-P01]

Formulation, Preparation, and Storage

H00001039-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: CDR2

CDR2 suppresses the transcriptional activity and DNA binding of nuclear factor-kappa B by an unknown mechanism. The neuron specific expression of CDR-2 is regulated by a post-transcriptional mechanism. CDR2 antibodies are useful tools for transcription regulation and neurology.

Alternate Names

CDR62, cerebellar degeneration-related protein (62kD), cerebellar degeneration-related protein 2, cerebellar degeneration-related protein 2, 62kDa, Major Yo paraneoplastic antigen, Paraneoplastic cerebellar degeneration-associated antigen, PCD17, Yo, Yo paraneoplastic antigen

Gene Symbol

CDR2

Additional CDR2 Products

Product Documents for Recombinant Human CDR2 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human CDR2 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Recombinant Human CDR2 GST (N-Term) Protein

There are currently no reviews for this product. Be the first to review Recombinant Human CDR2 GST (N-Term) Protein and earn rewards!

Have you used Recombinant Human CDR2 GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for Recombinant Human CDR2 GST (N-Term) Protein

Showing  1 - 1 of 1 FAQ Showing All
  • Q: I'm looking for an antibody against human CDR2 to recognize thymic epithelial cells. You have several anti CDR2 antibodies. Are they against a thymic epithelial antigen or against the cerebellar degeneration-related protein 2, 62kDa?

    A: Yes, the specific antibody you have inquired about is against cerebellar degeneration-related protein 2, 62 kDa. Moreover, all of our CDR2 primaries are against the same target.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Proteins and Enzymes
Loading...