CDT1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58114

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to CDT1(chromatin licensing and DNA replication factor 1) The peptide sequence was selected from the C terminal of CDT1. Peptide sequence PATPPATPPAASPSALKGVSQDLLERIRAKEAQKQLAQMTRCPEQEQRLQ. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CDT1 Antibody - BSA Free

Western Blot: CDT1 Antibody [NBP1-58114]

Western Blot: CDT1 Antibody [NBP1-58114]

Western Blot: CDT1 Antibody [NBP1-58114] - Sample Type: 3. rat brain extract (80ug) Primary Antibody Dilution: 2ug/ml Secondary Antibody: IRDye 800CW goat anti-rabbit Secondary Antibody Dilution: 1: 20,000
Immunocytochemistry/ Immunofluorescence: CDT1 Antibody [NBP1-58114]

Immunocytochemistry/ Immunofluorescence: CDT1 Antibody [NBP1-58114]

Immunocytochemistry/Immunofluorescence: CDT1 Antibody [NBP1-58114] - Mouse brain stem cells, 2 ug/ml.
Western Blot: CDT1 Antibody [NBP1-58114]

Western Blot: CDT1 Antibody [NBP1-58114]

Western Blot: CDT1 Antibody [NBP1-58114] - Sample Type : 3. rat brain extract (80ug) Primary Antibody Dilution: 2ug/ml Secondary Antibody : IRDye 800CW goat anti-rabbit Secondary Antibody Dilution: 1: 20,000

Applications for CDT1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:10-1:2000

Immunohistochemistry

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CDT1

CDT1 cooperates with CDC6 to promote the loading of the mini-chromosome maintenance complex onto chromatin to form the pre-replication complex necessary to initiate DNA replication. It binds DNA in a sequence-, strand-, and conformation-independent manner and is a potential oncogene.

Alternate Names

chromatin licensing and DNA replication factor 1, DNA replication factor Cdt1, Double parked homolog, Double parked, Drosophila, homolog of, DUPRIS2

Gene Symbol

CDT1

Additional CDT1 Products

Product Documents for CDT1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CDT1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CDT1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CDT1 Antibody - BSA Free and earn rewards!

Have you used CDT1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CDT1 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: Does this antibody work on mouse tissue with immunofluorescent protocols? Also which fixation method is recommended? Finally, is there any warranty for the antibody that will cover our purchase with a full refund in case this product does not work?

    A: All of our products are 100% guaranteed for the applications and species listed on the datasheet. In the case of NBP1-58114, it is guaranteed for use in Western blot and immunocytochemistry on human, mouse and rat samples. The image showing staining in mouse brain came from a customer. I have the following information regarding their protocol. Primary antibody dilution: 1:500, Secondary antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary antibody dilution: 1:1000, IHC Protocol: Incubate cells with 2N HCL for 30 min, Wash 3X in PBS, Stained for 1h 30 min with 1:500 antibody, Wash 3X in PBS, Incubated with goat anti-rabbit Alexa-Fluor 594 for 1h, Wash 3X in PBS, Co stain with DAPI, Images were taken with a 40X objective.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...