CEBP Delta Antibody (2O1A6)

Novus Biologicals | Catalog # NBP3-33314

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 2O1A6
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 50-150 of human CEBP Delta (NP_005186.2).

Sequence:
PAMYDDESAIDFSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLKREPDWGDGDAPGSLLPAQVAACAQTVVSLA

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CEBP Delta Antibody (2O1A6)

CEBP Delta Antibody (2O1A6)

Western Blot: CEBP Delta Antibody (2O1A6) [NBP3-33314] -

Western Blot: CEBP Delta Antibody (2O1A6) [NBP3-33314] - Western blot analysis of lysates from HeLa cells, using CEBP Delta Rabbit mAb at 1:200000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
CEBP Delta Antibody (2O1A6)

Western Blot: CEBP Delta Antibody (2O1A6) [NBP3-33314] -

Western Blot: CEBP Delta Antibody (2O1A6) [NBP3-33314] - Western blot analysis of lysates from 3T3-L1 cells, using CEBP Delta Rabbit mAb at 1:200000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 180s.

Applications for CEBP Delta Antibody (2O1A6)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:10000 - 1:200000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.05% Proclin 300

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CEBP Delta

C/EBP proteins are DNA-binding proteins that are important transcriptional activators in the regulation of genes involved in immune and inflammatory responses and may play an important role in the regulation of the several genes associated with activation and/or differentiation of macrophages. Members of the C/EBP transcription factor family are related by a high degree of amino acid sequence identity to the basic leucine zipper DNA-binding domain and show distinct but overlapping patterns of tissue- and stage-restricted expression. Osada et al. identified the consensus binding site for the family as RTTGCGYAAY (R = A or G, and Y = C or T). Phosphorylation of C/EBP delta may increase binding activity, whereas phosphorylation of the alpha and beta family members may decrease binding affinity. C/EBP delta is a nuclear protein that binds DNA as a dimer and can form stable heterodimers with all other C/EBP family members.

Alternate Names

C/EBP-delta, CCAAT/enhancer binding protein (C/EBP), delta, CCAAT/enhancer-binding protein delta, CELF, CRP3, NF-IL6-betaC/EBP delta, Nuclear factor NF-IL6-beta

Gene Symbol

CEBPD

Additional CEBP Delta Products

Product Documents for CEBP Delta Antibody (2O1A6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CEBP Delta Antibody (2O1A6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CEBP Delta Antibody (2O1A6)

There are currently no reviews for this product. Be the first to review CEBP Delta Antibody (2O1A6) and earn rewards!

Have you used CEBP Delta Antibody (2O1A6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...