CEND1 Antibody (1D3Z1)

Novus Biologicals | Catalog # NBP3-16614

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 1D3Z1 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 70-149 of human CEND1 (NP_057648.2). ALLNNHSNLKPAPTVPSSPDATPEPKGPGDGAEEDEAASGGPGGRGPWSCENFNPLLVAGGVAVAAIALILGVAFLVRKK

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CEND1 Antibody (1D3Z1)

Western Blot: CEND1 Antibody (1D3Z1) [NBP3-16614]

Western Blot: CEND1 Antibody (1D3Z1) [NBP3-16614]

Western Blot: CEND1 Antibody (1D3Z1) [NBP3-16614] - Western blot analysis of extracts of various cell lines, using CEND1 Rabbit mAb (NBP3-16614) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunocytochemistry/ Immunofluorescence: CEND1 Antibody (1D3Z1) [NBP3-16614]

Immunocytochemistry/ Immunofluorescence: CEND1 Antibody (1D3Z1) [NBP3-16614]

Immunocytochemistry/Immunofluorescence: CEND1 Antibody (1D3Z1) [NBP3-16614] - Immunofluorescence analysis of mouse brain cells using CEND1 Rabbit mAb (NBP3-16614) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: CEND1 Antibody (1D3Z1) [NBP3-16614]

Immunocytochemistry/ Immunofluorescence: CEND1 Antibody (1D3Z1) [NBP3-16614]

Immunocytochemistry/Immunofluorescence: CEND1 Antibody (1D3Z1) [NBP3-16614] - Immunofluorescence analysis of rat brain cells using CEND1 Rabbit mAb (NBP3-16614) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
CEND1 Antibody (1D3Z1)

Immunocytochemistry/ Immunofluorescence: CEND1 Antibody (1D3Z1) [NBP3-16614] -

Immunocytochemistry/ Immunofluorescence: CEND1 Antibody (1D3Z1) [NBP3-16614] - Confocal imaging of paraffin-embedded Rat brain tissue using CEND1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Microwave antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining. Objective: 40x.
CEND1 Antibody (1D3Z1)

Immunocytochemistry/ Immunofluorescence: CEND1 Antibody (1D3Z1) [NBP3-16614] -

Immunocytochemistry/ Immunofluorescence: CEND1 Antibody (1D3Z1) [NBP3-16614] - Confocal imaging of paraffin-embedded Mouse brain tissue using CEND1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Microwave antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining. Objective: 40x.

Applications for CEND1 Antibody (1D3Z1)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CEND1

Alternate Names

BM88 antigen, cell cycle exit and neuronal differentiation 1, cell cycle exit and neuronal differentiation protein 1, FLJ90066

Gene Symbol

CEND1

Additional CEND1 Products

Product Documents for CEND1 Antibody (1D3Z1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CEND1 Antibody (1D3Z1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CEND1 Antibody (1D3Z1)

There are currently no reviews for this product. Be the first to review CEND1 Antibody (1D3Z1) and earn rewards!

Have you used CEND1 Antibody (1D3Z1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...