CENPM Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58577

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CENPM Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TEESLRHVDASFFLGKVCFLATGAGRESHCSIHRHTVVKLAHTYQSPLLYCDLEVEG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CENPM Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: CENPM Antibody [NBP2-58577]

Immunocytochemistry/ Immunofluorescence: CENPM Antibody [NBP2-58577]

Immunocytochemistry/Immunofluorescence: CENPM Antibody [NBP2-58577] - Staining of human cell line HeLa shows localization to cytosol.

Applications for CENPM Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CENPM

The centromere is a specialized chromatin domain, present throughout the cell cycle, that acts as a platform on which the transient assembly of the kinetochore occurs during mitosis. All active centromeres are characterized by the presence of long arrays of nucleosomes in which CENPA (MIM 117139) replaces histone H3 (see MIM 601128). CENPM is an additional factor required for centromere assembly (Foltz et al., 2006 [PubMed 16622419]).[supplied by OMIM]

Alternate Names

bK250D10.2, C22orf18PANE1MGC861, CENP-Mchromosome 22 open reading frame 18, centromere protein M, ICEN39, Interphase centromere complex protein 39, Pane1, proliferation associated nuclear element 1, Proliferation-associated nuclear element protein 1

Gene Symbol

CENPM

Additional CENPM Products

Product Documents for CENPM Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CENPM Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CENPM Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CENPM Antibody - BSA Free and earn rewards!

Have you used CENPM Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies