Ceramide Kinase Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55991

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Ceramide Kinase Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VLHGLIGRTQRSAGVDQNHPRAVLVPSSLRIGIIPAGSTDCVCYSTVGTSDAETSALHIVVGDSLAMDVSSVHHNSTLL

Reactivity Notes

Mouse 85%, Rat 89%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Ceramide Kinase Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Ceramide Kinase Antibody [NBP2-55991]

Immunocytochemistry/ Immunofluorescence: Ceramide Kinase Antibody [NBP2-55991]

Immunocytochemistry/Immunofluorescence: Ceramide Kinase Antibody [NBP2-55991] - Staining of human cell line SH-SY5Y shows localization to vesicles. Antibody staining is shown in green.

Applications for Ceramide Kinase Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Ceramide Kinase

Ceramide kinase (CERK) is a novel lipid kinase. It is responsible for catalyzing the phosphorylation that produces a signaling lipid called ceramide-1-phosphate (C1P). C1P is an important biological mediator that induces inflammatory pathways such as those blocked by many allergy medications. Findings suggest that CERK could be a novel target for a new generation of anti-inflammatory/anti-trauma therapeutics dealing with such conditions as arthritis, asthma, multiple sclerosis, lung and colon cancers and Alzheimer's disease.

Long Name

Ceramide kinase

Alternate Names

CERK, EC 2.7.1.138, hCERK, KIAA1646, Lipid kinase 4, LK4

Gene Symbol

CERK

Additional Ceramide Kinase Products

Product Documents for Ceramide Kinase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Ceramide Kinase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Ceramide Kinase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Ceramide Kinase Antibody - BSA Free and earn rewards!

Have you used Ceramide Kinase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies