Recombinant Human CHIC2 GST (N-Term) Protein

Novus Biologicals | Catalog # H00026511-P01

Novus Biologicals
100% Guarantee

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Microarray
View all CHIC2 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-165 of Human CHIC2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASINRVNSCLKKNLPVNVRWLLCGCLCCCCTLGCSMWPVICLSKRTRRSIEKLLEWENNRLYHKLCLHWRLSKRKCETNNMMEYVILIEFLPKTPIFRPD

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

43.78 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Reviewed Applications

Read 1 review rated 5 using H00026511-P01 in the following applications:

Scientific Data Images for Recombinant Human CHIC2 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation, and Storage

H00026511-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: CHIC2

This gene encodes a member of the CHIC family of proteins. The encoded protein contains a cysteine-rich hydrophobic (CHIC) motif, and is localized to vesicular structures and the plasma membrane. This gene is associated with some cases of acute myeloid leukemia. CHIC2( AAH34691, 1 a.a. - 166 a.a.) recombinant protein with GST.

Alternate Names

BTLBrX-like translocated in leukemia, cysteine-rich hydrophobic domain 2, cysteine-rich hydrophobic domain 2 protein, cystein-rich hydrophobic domain 2, MGC21173

Gene Symbol

CHIC2

Additional CHIC2 Products

Product Documents for Recombinant Human CHIC2 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human CHIC2 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Recombinant Human CHIC2 GST (N-Term) Protein (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used Recombinant Human CHIC2 GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • Recombinant Human CHIC2 GST (N-Term) Protein
    Name: Paul Heisig
    Application: Binding assay/Protein-protein interaction
    Verified Customer | Posted 04/04/2023
    Recombinant Human CHIC2 GST (N-Term) Protein H00026511-P01

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes