Chitinase 3-like 1/YKL-40 (CHI3L1), also called BRP39 in mouse, is a 39 kDa glycoprotein member of the glycosyl hydrolase 18 family although it does not show chitotriosidase activity. CHI3L1 is expressed by articular chondrocytes, synovial cells, activated monocyte-derived macrophages, neutrophils, endothelial cells, vascular smooth muscle cells, and some cancer cells. CHI3L1 binds to chitin and heparins, and it enhances cell adhesion, proliferation and tumor angiogenesis. Circulating CHI3L1 is elevated during inflammation and connective tissue remodeling such as arthritis, chronic obstructive pulmonary disease, diabetes, cardiovascular disease, inflammatory bowel disease, and liver cirrhosis. It is frequently upregulated in glioblastoma, myxoid chondrosarcoma, melanoma and carcinomas of the breast, thyroid, colon, lung, kidney, and ovary.
Chitinase 3-like 1/YKL-40 Antibody (7T1R3)
Novus Biologicals | Catalog # NBP3-16077
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Mouse
Applications
Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 7T1R3 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 284-383 of human Chitinase 3-like 1 (NP_001267.2). PGRFTKEAGTLAYYEICDFLRGATVHRILGQQVPYATKGNQWVGYDDQESVKSKVQYLKDRQLAGAMVWALDLDDFQGSFCGQDLRFPLTNAIKDALAAT
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Description
Novus Biologicals Rabbit Chitinase 3-like 1/YKL-40 Antibody (7T1R3) (NBP3-16077) is a recombinant monoclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for Chitinase 3-like 1/YKL-40 Antibody (7T1R3)
Western Blot: Chitinase 3-like 1/YKL-40 Antibody (7T1R3) [NBP3-16077]
Western Blot: Chitinase 3-like 1 Antibody (9P1P6) [NBP3-16077] - Western blot analysis of extracts of THP-1 cells, using Chitinase 3-like 1 antibody (NBP3-16077) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.Western Blot: Chitinase 3-like 1/YKL-40 Antibody (7T1R3) [NBP3-16077]
Western Blot: Chitinase 3-like 1 Antibody (9P1P6) [NBP3-16077] - Western blot analysis of extracts of various cell lines, using Chitinase 3-like 1 antibody (NBP3-16077) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.Immunocytochemistry/ Immunofluorescence: Chitinase 3-like 1/YKL-40 Antibody (7T1R3) [NBP3-16077] -
Immunocytochemistry/ Immunofluorescence: Chitinase 3-like 1/YKL-40 Antibody (7T1R3) [NBP3-16077] - Confocal imaging of THP-1 cells using Chitinase 3-like 1/YKL-40 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 100x.Immunocytochemistry/ Immunofluorescence: Chitinase 3-like 1/YKL-40 Antibody (7T1R3) [NBP3-16077] -
Immunocytochemistry/ Immunofluorescence: Chitinase 3-like 1/YKL-40 Antibody (7T1R3) [NBP3-16077] - Confocal imaging of paraffin-embedded Rat brain tissue using Chitinase 3-like 1/YKL-40 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.Applications for Chitinase 3-like 1/YKL-40 Antibody (7T1R3)
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.05% Proclin 300
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Chitinase 3-like 1/YKL-40
Alternate Names
CHI3L1, Chitinase 3 like 1, HCgp39, YKL-40
Gene Symbol
CHI3L1
Additional Chitinase 3-like 1/YKL-40 Products
- All Products for Chitinase 3-like 1/YKL-40
- Chitinase 3-like 1/YKL-40 cDNA Clones
- Chitinase 3-like 1/YKL-40 ELISA Kits
- Chitinase 3-like 1/YKL-40 Luminex Assays
- Chitinase 3-like 1/YKL-40 Lysates
- Chitinase 3-like 1/YKL-40 Primary Antibodies
- Chitinase 3-like 1/YKL-40 Proteins and Enzymes
- Chitinase 3-like 1/YKL-40 Simple Plex
Product Documents for Chitinase 3-like 1/YKL-40 Antibody (7T1R3)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Chitinase 3-like 1/YKL-40 Antibody (7T1R3)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Chitinase 3-like 1/YKL-40 Antibody (7T1R3)
There are currently no reviews for this product. Be the first to review Chitinase 3-like 1/YKL-40 Antibody (7T1R3) and earn rewards!
Have you used Chitinase 3-like 1/YKL-40 Antibody (7T1R3)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Detection & Visualization of Antibody Binding
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...