Chitinase 3-like 1/YKL-40 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57913

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Monkey, Virus

Applications

Validated:

Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry-Frozen

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to CHI3L1(chitinase 3-like 1 (cartilage glycoprotein-39)) The peptide sequence was selected from the middle region of CHI3L1. Peptide sequence LDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Chitinase 3-like 1/YKL-40 Antibody - BSA Free

Western Blot: Chitinase 3-like 1/YKL-40 Antibody [NBP1-57913]

Western Blot: Chitinase 3-like 1/YKL-40 Antibody [NBP1-57913]

Western Blot: Chitinase 3-like 1 Antibody [NBP1-57913] - HepG2 tissue lysate at a concentration of 0.5ug/ml.
Immunocytochemistry/ Immunofluorescence: Chitinase 3-like 1/YKL-40 Antibody [NBP1-57913]

Immunocytochemistry/ Immunofluorescence: Chitinase 3-like 1/YKL-40 Antibody [NBP1-57913]

Immunocytochemistry/Immunofluorescence: Chitinase 3-like 1 Antibody [NBP1-57913] - simian immunodeficiency virus encephalitis Primary 1:2000 Secondary 1:200

Applications for Chitinase 3-like 1/YKL-40 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:10-1:2000

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Chitinase 3-like 1/YKL-40

CHI3L1 may play an important role in the capacity of cells to respond to and cope with changes in their environment. CHI3L1 may play a role in tissue remodeling and defense against pathogens. It belongs to the glycosyl hydrolase 18 family. CHI3L1 may play an important role in the capacity of cells to respond to and cope with changes in their environment.

Alternate Names

CHI3L1, Chitinase 3 like 1, HCgp39, YKL-40

Gene Symbol

CHI3L1

UniProt

Additional Chitinase 3-like 1/YKL-40 Products

Product Documents for Chitinase 3-like 1/YKL-40 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Chitinase 3-like 1/YKL-40 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Chitinase 3-like 1/YKL-40 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Chitinase 3-like 1/YKL-40 Antibody - BSA Free and earn rewards!

Have you used Chitinase 3-like 1/YKL-40 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Chitinase 3-like 1/YKL-40 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: Our customer would like to have CHI3L1 antibody for testing samples from dog... After searching, none can be found. However, we noticed that the sequence of NBP1-57913 is listed clearly as well as similarities of other species. We wonder if you can help compare with canine CHI3L1 as well.

    A: We have five antibodies to CHI3L1, all of which are raised against the human protein. The sequence entry of canine CHI3L1 has not been reviewed in Uniprot, however I ran an alignment for you between this and the human sequence, and found the homology to be 82%. Therefore it is likely, but not confirmed, that antibodies which bind the human protein may recognise canine CHI3L1. The homology between the immunogen sequence used to generate NBP1-57913 and the full length canine sequence is 84%. The homology between the immunogen sequence used to generate NBP1-28610 and the full length canine sequence is 83%. Your customer may be interested in our Innovators Reward Program, which allows them to try our primary antibodies in an untested species or application without the financial risk of failure. They could try one of our CHI3L1 antibodies against canine samples, share their results (including an image) with us, and receive a voucher for 100% of the purchase price of the reviewed product.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...