CHMP5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49227

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (96%), Rat (96%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: KAYKQVKIDQIEDLQDQLEDMMEDANEIQEALSRSYGTPELDEDDLEAELD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CHMP5 Antibody - BSA Free

Western Blot: CHMP5 Antibody [NBP2-49227]

Western Blot: CHMP5 Antibody [NBP2-49227]

Western Blot: CHMP5 Antibody [NBP2-49227] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human Kidney tissue
Immunohistochemistry-Paraffin: CHMP5 Antibody [NBP2-49227]

Immunohistochemistry-Paraffin: CHMP5 Antibody [NBP2-49227]

Immunohistochemistry-Paraffin: CHMP5 Antibody [NBP2-49227] - Staining of human lymph node.
Immunohistochemistry-Paraffin: CHMP5 Antibody [NBP2-49227]

Immunohistochemistry-Paraffin: CHMP5 Antibody [NBP2-49227]

Immunohistochemistry-Paraffin: CHMP5 Antibody [NBP2-49227] - Staining of human kidney shows cytoplasmic positivity in renal tubules.
Immunohistochemistry-Paraffin: CHMP5 Antibody [NBP2-49227]

Immunohistochemistry-Paraffin: CHMP5 Antibody [NBP2-49227]

Immunohistochemistry-Paraffin: CHMP5 Antibody [NBP2-49227] - Staining of human colon, kidney, liver and lymph node using Anti-CHMP5 antibody NBP2-49227 (A) shows similar protein distribution across tissues to independent antibody NBP2-48776 (B).
Immunohistochemistry-Paraffin: CHMP5 Antibody [NBP2-49227]

Immunohistochemistry-Paraffin: CHMP5 Antibody [NBP2-49227]

Immunohistochemistry-Paraffin: CHMP5 Antibody [NBP2-49227] - Staining of human kidney.
Immunohistochemistry-Paraffin: CHMP5 Antibody [NBP2-49227]

Immunohistochemistry-Paraffin: CHMP5 Antibody [NBP2-49227]

Immunohistochemistry-Paraffin: CHMP5 Antibody [NBP2-49227] - Staining of human liver.
Immunohistochemistry-Paraffin: CHMP5 Antibody [NBP2-49227]

Immunohistochemistry-Paraffin: CHMP5 Antibody [NBP2-49227]

Immunohistochemistry-Paraffin: CHMP5 Antibody [NBP2-49227] - Staining of human colon.

Applications for CHMP5 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CHMP5

CHMP5 is a component of the ESCRT-III complex, which is required for multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. The MVB pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. The ESCRT-III complex is probably involved in the concentration of MVB cargo. In case of infection, the HIV-1 virus takes advantage of the ESCRT-III complex for budding and exocytic cargoes of viral proteins.

Alternate Names

apoptosis-related protein PNAS-2, C9orf83, charged multivesicular body protein 5, chromatin modifying protein 5, Chromatin-modifying protein 5, chromosome 9 open reading frame 83, HSPC177, hVps60, PNAS-2, SNF7 domain containing 2, SNF7 domain-containing protein 2, SNF7DC2, Vacuolar protein sorting-associated protein 60, Vps60CGI-34

Gene Symbol

CHMP5

Additional CHMP5 Products

Product Documents for CHMP5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CHMP5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CHMP5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CHMP5 Antibody - BSA Free and earn rewards!

Have you used CHMP5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...