Cholecystokinin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-62664

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CCK Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: LQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMG

Reactivity Notes

Mouse (84%), Rat (82%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Cholecystokinin Antibody - BSA Free

Immunohistochemistry-Paraffin: Cholecystokinin Antibody [NBP2-62664]

Immunohistochemistry-Paraffin: Cholecystokinin Antibody [NBP2-62664]

Immunohistochemistry-Paraffin: Cholecystokinin Antibody [NBP2-62664] - Analysis in human duodenum and skeletal muscle tissues using Anti-CCK antibody. Corresponding CCK RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Cholecystokinin Antibody [NBP2-62664]

Immunohistochemistry-Paraffin: Cholecystokinin Antibody [NBP2-62664]

Immunohistochemistry-Paraffin: Cholecystokinin Antibody [NBP2-62664] - Staining of human hypothalamus shows strong positivity in neuronal projections.
Immunohistochemistry-Paraffin: Cholecystokinin Antibody [NBP2-62664]

Immunohistochemistry-Paraffin: Cholecystokinin Antibody [NBP2-62664]

Immunohistochemistry-Paraffin: Cholecystokinin Antibody [NBP2-62664] - Staining of human duodenum shows high expression.
Immunohistochemistry-Paraffin: Cholecystokinin Antibody [NBP2-62664]

Immunohistochemistry-Paraffin: Cholecystokinin Antibody [NBP2-62664]

Immunohistochemistry-Paraffin: Cholecystokinin Antibody [NBP2-62664] - Staining of human skeletal muscle shows low expression as expected.
Cholecystokinin Antibody - BSA Free

Immunohistochemistry: Rabbit Polyclonal Cholecystokinin Antibody [NBP2-62664]

4% PFA fixed, frozen human small intestine samples. Cholecystokinin Antibody used at 1:200 dilution with 0.2% Triton X-100. Image from a verified customer review.

Applications for Cholecystokinin Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CCK

The regulated translation of messenger RNA is essential for cell-cycle progression, establishment of the body plan during early development and modulation of key activities in the central nervous system. Cytoplasmic polyadenylation, one mechanism of controlling translation, is driven by cytoplasmic polyadenylation element binding protein, CPEB. CPEB is a highly conserved, sequence-specific RNA-binding protein that binds to the cytoplasmic polyadenylation element, thereby modulating translational repression and mRNA localization. Blocking cytoplasmic polyadenylation by interfering with the CPE or CPEB prevents the translational activation and translational repression of mRNAs crucial for oocyte maturation. CPEB is synthesized during oogenesis and stockpiled in the oocyte. CPEB degradation occurs via the proteasome pathway, most likely through ubiquitin-conjugated intermediates.

Long Name

Cholecystokinin

Alternate Names

cholecystokinin, MGC117187

Gene Symbol

CCK

Additional CCK Products

Product Documents for Cholecystokinin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Cholecystokinin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cholecystokinin Receptors

Citations for Cholecystokinin Antibody - BSA Free

Customer Reviews for Cholecystokinin Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used Cholecystokinin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • Name: Anonymous
    Verified Customer | Posted 10/16/2025
    CCK used in 1:200 dilution co-localised with Chromogranin A
    4% PFA fixed, frozen human small intestine samples. CCK used at 1:200 dilution with 0.2% Triton X-100.
    Cholecystokinin Antibody - BSA Free NBP2-62664

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies