Clathrin light chain Antibody (4E9) - Azide and BSA Free

Novus Biologicals | Catalog # H00001211-M08

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 4E9

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

CLTA (NP_001824.1, 118 a.a. ~ 176 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESS

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for Clathrin light chain Antibody (4E9) - Azide and BSA Free

Western Blot: Clathrin light chain Antibody (4E9) [H00001211-M08]

Western Blot: Clathrin light chain Antibody (4E9) [H00001211-M08]

Western Blot: Clathrin light chain Antibody (4E9) [H00001211-M08] - Analysis of CLTA expression in human kidney.
Sandwich ELISA: Clathrin light chain Antibody (4E9) [H00001211-M08] - Detection limit for recombinant GST tagged CLTA is 0.03 ng/ml as a capture antibody.

Applications for Clathrin light chain Antibody (4E9) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
It has been used for ELISA and WB.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Clathrin light chain

Clathrin is a large, soluble protein composed of heavy and light chains. It functions as the main structural component of the lattice-type cytoplasmic face of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. This gene encodes one of two clathrin light chain proteins which are believed to function as regulatory elements. Alternative splicing results in multiple transcript variants. Transcript Variant: This variant (1) lacks alternate in-frame exons, compared to variant 2, resulting in a shorter protein (isoform a), compared to isoform b. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

clathrin light chain A, clathrin, light chain A, Lca, light polypeptide (Lca)

Gene Symbol

CLTA

Additional Clathrin light chain Products

Product Documents for Clathrin light chain Antibody (4E9) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Clathrin light chain Antibody (4E9) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Clathrin light chain Antibody (4E9) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Clathrin light chain Antibody (4E9) - Azide and BSA Free and earn rewards!

Have you used Clathrin light chain Antibody (4E9) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...