Claudin-16 Antibody (1F2) - Azide and BSA Free

Novus Biologicals | Catalog # H00010686-M02

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 1F2

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

CLDN16 (UniProt Accession # A0SDD8, 1 a.a. ~ 73 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTSRTPLLVTACLYYSYCNSRHLQQGVRKSKRPVFSHCQVPETQKTDTRHLSGARAGVCPCCHPDGLLATMRD

This sequence also corresponds to transcript ID ENST00000456423.1.

Specificity

CLDN16 - claudin 16 (1F2)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for Claudin-16 Antibody (1F2) - Azide and BSA Free

Western Blot: Claudin-16 Antibody (1F2) [H00010686-M02]

Western Blot: Claudin-16 Antibody (1F2) [H00010686-M02]

Western Blot: Claudin-16 Antibody (1F2) [H00010686-M02] - Analysis of CLDN16 expression in transfected 293T cell line by CLDN16 monoclonal antibody (M02), clone 1F2.Lane 1: CLDN16 transfected lysate(33.8 KDa).Lane 2: Non-transfected lysate.
ELISA: Claudin-16 Antibody (1F2) [H00010686-M02]

ELISA: Claudin-16 Antibody (1F2) [H00010686-M02]

ELISA: Claudin-16 Antibody (1F2) [H00010686-M02] - Detection limit for recombinant GST tagged CLDN16 is 0.3 ng/ml as a capture antibody.

Applications for Claudin-16 Antibody (1F2) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Claudin-16

Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. It is found primarily in the kidneys, specifically in the thick ascending limb of Henle, where it acts as either an intercellular pore or ion concentration sensor to regulate the paracellular resorption of magnesium ions. Defects in this gene are a cause of primary hypomagnesemia, which is characterized by massive renal magnesium wasting with hypomagnesemia and hypercalciuria, resulting in nephrocalcinosis and renal failure. [provided by RefSeq]

Alternate Names

Claudin16, CLDN16, HOMG3, Paracellin-1, PCLN1

Entrez Gene IDs

10686 (Human)

Gene Symbol

CLDN16

UniProt

Additional Claudin-16 Products

Product Documents for Claudin-16 Antibody (1F2) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Claudin-16 Antibody (1F2) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Claudin-16 Antibody (1F2) - Azide and BSA Free

Customer Reviews for Claudin-16 Antibody (1F2) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Claudin-16 Antibody (1F2) - Azide and BSA Free and earn rewards!

Have you used Claudin-16 Antibody (1F2) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...