Claudin-18 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-32002

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Claudin-18 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: MMCIACRGLAPEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDYV

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (80%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Claudin-18 Antibody - BSA Free

Immunohistochemistry-Paraffin: Claudin-18 Antibody [NBP2-32002]

Immunohistochemistry-Paraffin: Claudin-18 Antibody [NBP2-32002]

Immunohistochemistry-Paraffin: Claudin-18 Antibody [NBP2-32002] - analysis in human stomach and liver tissues. Corresponding CLDN18 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Claudin-18 Antibody [NBP2-32002]

Immunohistochemistry-Paraffin: Claudin-18 Antibody [NBP2-32002]

Immunohistochemistry-Paraffin: Claudin-18 Antibody [NBP2-32002] - Staining of human stomach shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: Claudin-18 Antibody [NBP2-32002]

Immunohistochemistry-Paraffin: Claudin-18 Antibody [NBP2-32002]

Immunohistochemistry-Paraffin: Claudin-18 Antibody [NBP2-32002] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: Claudin-18 Antibody [NBP2-32002]

Immunohistochemistry-Paraffin: Claudin-18 Antibody [NBP2-32002]

Immunohistochemistry-Paraffin: Claudin-18 Antibody [NBP2-32002] - Staining of human tonsil shows weak to moderate membranous positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: Claudin-18 Antibody [NBP2-32002]

Immunohistochemistry-Paraffin: Claudin-18 Antibody [NBP2-32002]

Immunohistochemistry-Paraffin: Claudin-18 Antibody [NBP2-32002] - Staining of human stomach cancer shows moderate to strong membranous positivity in tumor cells.
Immunohistochemistry-Paraffin: Claudin-18 Antibody [NBP2-32002]

Immunohistochemistry-Paraffin: Claudin-18 Antibody [NBP2-32002]

Immunohistochemistry-Paraffin: Claudin-18 Antibody [NBP2-32002] - Staining of human lung shows moderate membranous positivity in pneumocytes.
Immunohistochemistry-Paraffin: Claudin-18 Antibody [NBP2-32002]

Immunohistochemistry-Paraffin: Claudin-18 Antibody [NBP2-32002]

Immunohistochemistry-Paraffin: Claudin-18 Antibody [NBP2-32002] - Staining of human pancreatic cancer shows moderate membranous positivity in tumor cells.

Applications for Claudin-18 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Claudin-18

This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. This gene is upregulated in patients with ulcerative colitis and highly overexpressed in infiltrating ductal adenocarcinomas. PKC/MAPK/AP-1 (protein kinase C/mitogen-activated protein kinase/activator protein-1) dependent pathway regulates the expression of this gene in gastric cells. Alternatively spliced transcript variants encoding different isoforms have been identified.

Alternate Names

Claudin18, CLDN18, SFTA5, SFTPJ

Gene Symbol

CLDN18

UniProt

P56856 (Human)

Additional Claudin-18 Products

Product Documents for Claudin-18 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Claudin-18 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cancer Biomarkers

Customer Reviews for Claudin-18 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Claudin-18 Antibody - BSA Free and earn rewards!

Have you used Claudin-18 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies