CLCA1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49060

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CLCA1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: VGMVTFDSAAHVQSELIQINSGSDRDTLAKRLPAAASGGTSICSGLRSAFTVIRKKYPTDGSEIVLLTD

Reactivity Notes

Mouse (81%), Rat (80%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit CLCA1 Antibody - BSA Free (NBP2-49060) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for CLCA1 Antibody - BSA Free

Immunohistochemistry-Paraffin: CLCA1 Antibody [NBP2-49060]

Immunohistochemistry-Paraffin: CLCA1 Antibody [NBP2-49060]

Immunohistochemistry-Paraffin: CLCA1 Antibody [NBP2-49060] - Staining in human small intestine and liver tissues using anti-CLCA1 antibody. Corresponding CLCA1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CLCA1 Antibody [NBP2-49060]

Immunohistochemistry-Paraffin: CLCA1 Antibody [NBP2-49060]

Immunohistochemistry-Paraffin: CLCA1 Antibody [NBP2-49060] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: CLCA1 Antibody [NBP2-49060]

Immunohistochemistry-Paraffin: CLCA1 Antibody [NBP2-49060]

Immunohistochemistry-Paraffin: CLCA1 Antibody [NBP2-49060] - Staining of human colon, liver, small intestine and testis using Anti-CLCA1 antibody NBP2-49060 (A) shows similar protein distribution across tissues to independent antibody NBP2-38869 (B).
CLCA1 Antibody

Immunohistochemistry-Paraffin: CLCA1 Antibody [NBP2-49060] -

Immunohistochemistry-Paraffin: CLCA1 Antibody [NBP2-49060] -Staining of human duodenum shows strong cytoplasmic positivity in goblet cells.
CLCA1 Antibody

Immunohistochemistry-Paraffin: CLCA1 Antibody [NBP2-49060] -

Immunohistochemistry-Paraffin: CLCA1 Antibody [NBP2-49060] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.
CLCA1 Antibody

Immunohistochemistry-Paraffin: CLCA1 Antibody [NBP2-49060] -

Immunohistochemistry-Paraffin: CLCA1 Antibody [NBP2-49060] -Staining of human colon shows strong cytoplasmic positivity in goblet cells.
CLCA1 Antibody

Immunohistochemistry-Paraffin: CLCA1 Antibody [NBP2-49060] -

Immunohistochemistry-Paraffin: CLCA1 Antibody [NBP2-49060] -Staining of human skeletal muscle shows no positivity in myocytes as expected.

Applications for CLCA1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CLCA1

CLCA1 encodes a member of the calcium sensitive chloride conductance protein family. To date, all members of this gene family map to the same region on chromosome 1p31-p22 and share a high degree of homology in size, sequence, and predicted structure, but differ significantly in their tissue distributions. The encoded protein is expressed as a precursor protein that is processed into two cell-surface-associated subunits, although the site at which the precursor is cleaved has not been precisely determined. The encoded protein may be involved in mediating calcium-activated chloride conductance in the intestine. [provided by RefSeq]

Long Name

Chloride Channel Accessory 1

Alternate Names

CaCC-1, CLCRG1, GOB5, HCLCA1

Gene Symbol

CLCA1

Additional CLCA1 Products

Product Documents for CLCA1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CLCA1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Ion Channels and Regulators

Customer Reviews for CLCA1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CLCA1 Antibody - BSA Free and earn rewards!

Have you used CLCA1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies