CLCN4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57670

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CLCN4 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MVNAGAMSGSGNLMDFLDEPFPDVGTYEDFH

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CLCN4 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: CLCN4 Antibody [NBP2-57670]

Immunocytochemistry/ Immunofluorescence: CLCN4 Antibody [NBP2-57670]

Immunocytochemistry/Immunofluorescence: CLCN4 Antibody [NBP2-57670] - Staining of human cell line PC-3 shows localization to vesicles. Antibody staining is shown in green.

Applications for CLCN4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CLCN4

The family of voltage-dependent chloride channels (CLCs) regulate cellular trafficking of chloride ions, a critical component of all living cells. CLCs regulate excitability in muscle and nerve cells, aid in organic solute transport and maintain cellular volume. The genes encoding human CLC-1 through CLC-7 map to chromosomes 7, 3q26, 4q32, Xp22, Xp11, 1p36 and 16p13, respectively. CLC-1 is highly expressed in skeletal muscle. Mutations in the gene encoding CLC-1 lead to myotonia, an inheritable disorder characterized by muscle stiffness and renal salt wasting. CLC-2 is highly expressed in the epithelia of several organs including lung, which suggests CLC-2 may be a possible therapeutic target for cystic fibrosis. CLC-3 expression is particularly abundant in neuronal tissue, while CLC-4 expression is evident in skeletal and cardiac muscle as well as brain. Mutations in the gene encoding CLC-5 lead to Dent's disease, a renal disorder characterized by proteinuria and hypercalciuria. CLC-6 and CLC-7 are broadly expressed in several tissues including testes, kidney, brain and muscle.

Alternate Names

chloride channel 4, Chloride channel protein 4, Chloride transporter ClC-4, CLC4, ClC-4, ClC-4A, H(+)/Cl(-) exchange transporter 4, MGC163150

Gene Symbol

CLCN4

Additional CLCN4 Products

Product Documents for CLCN4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CLCN4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CLCN4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CLCN4 Antibody - BSA Free and earn rewards!

Have you used CLCN4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies