CLN6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-17819

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CLN6 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VGDSVNHRLLFSGYQHHLSVRENPIIKNLKPETLIDSFELLYYYDEYL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CLN6 Antibody - BSA Free

Western Blot: CLN6 Antibody [NBP3-17819]

Western Blot: CLN6 Antibody [NBP3-17819]

Western Blot: CLN6 Antibody [NBP3-17819] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10; Lane 2: RT4; Lane 3: U-251 MG
Immunocytochemistry/ Immunofluorescence: CLN6 Antibody [NBP3-17819]

Immunocytochemistry/ Immunofluorescence: CLN6 Antibody [NBP3-17819]

Immunocytochemistry/Immunofluorescence: CLN6 Antibody [NBP3-17819] - Staining of human cell line U-2 OS shows localization to nucleoli, endoplasmic reticulum & vesicles.

Applications for CLN6 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CLN6

CLN6, a 311-amino acid protein, has 7 predicted transmembrane domains and is conserved across vertebrates. The CLN6 protein localizes to the endoplasmic reticulum but contributes to lysosomal function. Mutations in the CLN6 gene cause variant late-onset infantile neuronal ceroid lipofuscinosis (vLINCL), a lysosomal storage disorder marked by progressive mental deterioration and blindness; part of a group of severe inherited neurodegenerative disorders affecting children wherein lysosomes accumulate storage material, causing the death of neurons. CLN6 is one of eight proteins, including CLN1-8, that are associated with NCL.

Alternate Names

ceroid-lipofuscinosis neuronal protein 6, ceroid-lipofuscinosis, neuronal 6, late infantile, variant, FLJ20561, HsT18960, nclf, Protein CLN6

Gene Symbol

CLN6

Additional CLN6 Products

Product Documents for CLN6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CLN6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CLN6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CLN6 Antibody - BSA Free and earn rewards!

Have you used CLN6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies