CML2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-03797

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CML2 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 75-165 of human CML2 (NP_057431.2). WFLAKKPWTRYVDIALRTDMSDITKSYLSECGSCFWVGESEEKVVGTVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKALVRTVLQFA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CML2 Antibody - BSA Free

CML2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: CML2 Antibody - BSA Free [NBP3-03797] -

Immunocytochemistry/ Immunofluorescence: CML2 Antibody - BSA Free [NBP3-03797] - Immunofluorescence analysis of A549 cells using CML2 Rabbit pAb (A13428). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for CML2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:200

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CML2

CML2 is encoded by this gene is highly similar to the N-acetyltransferase 8 (NAT8) gene product, which is a kidney and liver protein with homology to bacterial acetyltransferases involved in drug resistance. This gene is localized on chromosome 2 in the vicinity of the NAT8 gene and may represent a pseudogene of NAT8. This gene contains two polymorphic nonsense mutations that disrupt the active site of the protein. The full-length product of this gene contains a complete acetyltransferase domain and is identical in length to NAT8. [provided by RefSeq]

Alternate Names

Camello-like protein 2, CML2, EC 2.3.1, EC 2.3.1.-, Hcml2, MGC97061, N-acetyltransferase 8B (GCN5-related, putative, gene/pseudogene), N-acetyltransferase 8B (gene/pseudogene), N-acetyltransferase Camello 2, NAT8BP, probable N-acetyltransferase 8B

Gene Symbol

NAT8B

Additional CML2 Products

Product Documents for CML2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CML2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CML2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CML2 Antibody - BSA Free and earn rewards!

Have you used CML2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies