CNOT2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56034

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DGSENVTGLDLSDFPALADRNRREGSGNPTPLINPLAGRAPYVGMVTKPANEQSQDFSIHNEDFPALPGSSYKDPT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CNOT2 Antibody - BSA Free

Western Blot: CNOT2 Antibody [NBP2-56034]

Western Blot: CNOT2 Antibody [NBP2-56034]

Western Blot: CNOT2 Antibody [NBP2-56034] - Analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: CNOT2 Antibody [NBP2-56034]

Immunocytochemistry/ Immunofluorescence: CNOT2 Antibody [NBP2-56034]

Immunocytochemistry/Immunofluorescence: CNOT2 Antibody [NBP2-56034] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CNOT2 Antibody [NBP2-56034]

Immunohistochemistry-Paraffin: CNOT2 Antibody [NBP2-56034]

Immunohistochemistry-Paraffin: CNOT2 Antibody [NBP2-56034] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: CNOT2 Antibody [NBP2-56034]

Immunohistochemistry-Paraffin: CNOT2 Antibody [NBP2-56034]

Immunohistochemistry-Paraffin: CNOT2 Antibody [NBP2-56034] - Staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: CNOT2 Antibody [NBP2-56034]

Immunohistochemistry-Paraffin: CNOT2 Antibody [NBP2-56034]

Immunohistochemistry-Paraffin: CNOT2 Antibody [NBP2-56034] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: CNOT2 Antibody [NBP2-56034]

Immunohistochemistry-Paraffin: CNOT2 Antibody [NBP2-56034]

Immunohistochemistry-Paraffin: CNOT2 Antibody [NBP2-56034] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
CNOT2 Antibody - BSA Free

Western Blot: CNOT2 Antibody - BSA Free [NBP2-56034] -

Validation of interactome data by co-IP.(A) Co-IPs validating that UL72 interacts with CCR4-NOT Transcription Complex Subunits 7 and 2 (CNOT7 and CNOT2), conducted in HEK293T cells. For all experiments in this figure, left panels show an IB of 1–2% of input sample, and right panels shown an anti-V5 co-IP. Cells were transiently transfected with two plasmids, one expressing the C-terminally V5-tagged viral protein and the other expressing the C-terminally HA-tagged cellular prey. Bait proteins were detected with anti-V5, and prey with antibodies against CNOT7 or CNOT2 protein. Controls included GFP or the viral UL34 protein. CANX – calnexin loading control. This figure is representative of n = 1 experiment (CNOT2); n = 2 experiments (CNOT7). Expected sizes: CNOT7: 33 kDa; CNOT2: 52 kDa; CANX: 72 kDa; UL72: 44 kDa; UL34: 45 kDa. (B) Co-IPs validating that UL72 interacts with CNOT7 and CNOT2, conducted in HFFF-TERT cells overexpressing C-terminally V5-tagged UL72. Proteins were detected as described in (A). This figure is representative of n = 2 experiments (CNOT2); n = 1 experiment (CNOT7). Expected sizes: CNOT7: 33 kDa; CNOT2: 52 kDa; CANX: 72 kDa; UL72: 44 kDa; UL34: 45 kDa. (C) Co-IP validating the interaction between RL1 and CUL4A, conducted in HEK293T cells as described in (A), but with detection of CUL4A using anti-HA. This figure is representative of n = 4 experiments. Expected sizes: CUL4A: 77 kDa; RL1: 35 kDa; UL34: 45 kDa; CANX: 72 kDa. (D) HCMV UL71 interacted with multiple interferon-stimulated proteins, including TRIM22. (E) Co-IP validating the interaction between UL71 and TRIM22, conducted as described in (C). This figure is representative of n = 3 experiments. Expected sizes: TRIM22: 56 kDa; UL71: 40 kDa; UL34: 45 kDa; CANX: 72 kDa. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/31873071), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for CNOT2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CNOT2

The CCR4-NOT complex functions as general transcription regulation complex

Alternate Names

CCR4-associated factor 2, CCR4-NOT transcription complex, subunit 2, CDC36FLJ26456, negative regulator of transcription 2, NOT2CCR4-NOT transcription complex subunit 2, NOT2H

Gene Symbol

CNOT2

Additional CNOT2 Products

Product Documents for CNOT2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CNOT2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for CNOT2 Antibody - BSA Free

Customer Reviews for CNOT2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CNOT2 Antibody - BSA Free and earn rewards!

Have you used CNOT2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...