Coagulation Factor II/Thrombin Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-33728
![Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP2-33728]](https://beta-resources.rndsystems.com/images/products/F2-Antibody-Immunohistochemistry-Paraffin-NBP2-33728-img0004.jpg "Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP2-33728]")
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EGVWCYVAGKPGDFGYCDLNYCEEAVEEETGDGLDEDSDRAIEGRTATSEYQTFFNPRTFGSGEADCGLRPLFEKKSLE
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
Novus Biologicals Rabbit Coagulation Factor II/Thrombin Antibody - BSA Free (NBP2-33728) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for Coagulation Factor II/Thrombin Antibody - BSA Free
Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP2-33728]
Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP2-33728] - F2 Antibody [NBP2-33728] - Staining in human liver and pancreas tissues using anti-F2 antibody. Corresponding F2 RNA-seq data are presented for the same tissues.![Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP2-33728]](https://beta-resources.rndsystems.com/images/products/F2-Antibody-Immunohistochemistry-Paraffin-NBP2-33728-img0003.jpg "Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP2-33728]")
Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP2-33728]
Immunohistochemistry-Paraffin: F2 Antibody [NBP2-33728] - Staining of human pancreas shows low expression as expected.![Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP2-33728]](https://beta-resources.rndsystems.com/images/products/F2-Antibody-Immunohistochemistry-Paraffin-NBP2-33728-img0002.jpg "Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP2-33728]")
Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP2-33728]
Immunohistochemistry-Paraffin: F2 Antibody [NBP2-33728] - Staining of human liver shows high expression.Applications for Coagulation Factor II/Thrombin Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Coagulation Factor II/Thrombin
Additional Coagulation Factor II/Thrombin Products
Product Documents for Coagulation Factor II/Thrombin Antibody - BSA Free
Product Specific Notices for Coagulation Factor II/Thrombin Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Coagulation Factor II/Thrombin Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Coagulation Factor II/Thrombin Antibody - BSA Free and earn rewards!
Have you used Coagulation Factor II/Thrombin Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for Coagulation Factor II/Thrombin Antibody - BSA Free
Showing
1
-
1 of
1 FAQ
Showing All
-
A: We currently have 1 neutralizing Thrombin antibody (NBP1-95029), however it is an anti-human antibody and has only been validated in human samples. If you would like to test this antibody in mouse samples, you may be interested in participating in our Innovators Reward Program.
Loading...
Associated Pathways
