Coagulation Factor II/Thrombin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33728

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: EGVWCYVAGKPGDFGYCDLNYCEEAVEEETGDGLDEDSDRAIEGRTATSEYQTFFNPRTFGSGEADCGLRPLFEKKSLE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Coagulation Factor II/Thrombin Antibody - BSA Free

Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP2-33728]

Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP2-33728]

Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP2-33728] - F2 Antibody [NBP2-33728] - Staining in human liver and pancreas tissues using anti-F2 antibody. Corresponding F2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP2-33728]

Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP2-33728]

Immunohistochemistry-Paraffin: F2 Antibody [NBP2-33728] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP2-33728]

Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP2-33728]

Immunohistochemistry-Paraffin: F2 Antibody [NBP2-33728] - Staining of human liver shows high expression.

Applications for Coagulation Factor II/Thrombin Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Coagulation Factor II/Thrombin

Proteinase-activated receptor 3 (PAR3) is a member of the Proteinase-Activated Receptor subfamily. The enzyme thrombin is involved in the activation of platelets, leukocytes, endothelial cells, and mesenchymal cells at sites of vascular injury. These cellular responses are triggered through proteolytic activation of PAR3 and other receptors by thrombin. It is believed that PAR3 functions as a cofactor for the cleavage and activation of PAR4. PAR3 expression has been documented in blood, bone marrow, lung, spleen, and vessel. ESTs have been isolated from head/neck, skeletal muscle, and skin libraries.

Alternate Names

F2, Thrombin

Gene Symbol

F2

UniProt

Additional Coagulation Factor II/Thrombin Products

Product Documents for Coagulation Factor II/Thrombin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Coagulation Factor II/Thrombin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Coagulation Factor II/Thrombin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Coagulation Factor II/Thrombin Antibody - BSA Free and earn rewards!

Have you used Coagulation Factor II/Thrombin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Coagulation Factor II/Thrombin Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: Do you have neutralizing antibodies for anti-mouse Thrombin?

    A: We currently have 1 neutralizing Thrombin antibody (NBP1-95029), however it is an anti-human antibody and has only been validated in human samples. If you would like to test this antibody in mouse samples, you may be interested in participating in our Innovators Reward Program.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...

Associated Pathways

Blood Coagulation Signaling Pathways Blood Coagulation Signaling Pathway Thumbnail