Coagulation Factor III/Tissue Factor Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55950

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Coagulation Factor III/Tissue Factor Antibody - BSA Free

Western Blot: Coagulation Factor III/Tissue Factor Antibody [NBP2-55950]

Western Blot: Coagulation Factor III/Tissue Factor Antibody [NBP2-55950]

Western Blot: Coagulation Factor III/Tissue Factor Antibody [NBP2-55950] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: Coagulation Factor III/Tissue Factor Antibody [NBP2-55950]

Immunocytochemistry/ Immunofluorescence: Coagulation Factor III/Tissue Factor Antibody [NBP2-55950]

Immunocytochemistry/Immunofluorescence: Coagulation Factor III/Tissue Factor Antibody [NBP2-55950] - Staining of human cell line HaCaT shows localization to vesicles.

Applications for Coagulation Factor III/Tissue Factor Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Coagulation Factor III/Tissue Factor

Tissue Factor encodes coagulation factor III which is a cell surface glycoprotein. This factor enables cells to initiate the blood coagulation cascades, and it functions as the high-affinity receptor for the coagulation factor VII. The resulting complex provides a catalytic event that is responsible for initiation of the coagulation protease cascades by specific limited proteolysis. Unlike the other cofactors of these protease cascades, which circulate as nonfunctional precursors, this factor is a potent initiator that is fully functional when expressed on cell surfaces. There are 3 distinct domains of this factor: extracellular, transmembrane, and cytoplasmic. This protein is the only one in the coagulation pathway for which a congenital deficiency has not been described. [provided by RefSeq]

Alternate Names

CD142, F3, Thromboplastin, Tissue Factor

Gene Symbol

F3

Additional Coagulation Factor III/Tissue Factor Products

Product Documents for Coagulation Factor III/Tissue Factor Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Coagulation Factor III/Tissue Factor Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Coagulation Factor III/Tissue Factor Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Coagulation Factor III/Tissue Factor Antibody - BSA Free and earn rewards!

Have you used Coagulation Factor III/Tissue Factor Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Coagulation Factor III/Tissue Factor Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: Have you tested any of your anti-tissue factor antibodies against pig? I need one for western blot.

    A: Unfortunately, none of our Tissue Factor antibodies have yet been tested with pig samples, so we cannot guarantee that any of them will work in pig. Here is a link to Tissue Factor antibodies that have been validated for use in Western blot. If you are interested in testing any of these antibodies against pig samples, you could become eligible for our Innovator's Reward program.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...

Associated Pathways

Blood Coagulation Signaling Pathways Blood Coagulation Signaling Pathway Thumbnail