COL1A2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-24756

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (92%), Rat (92%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all COL1A2 Primary Antibodies »

Product Specifications

Immunogen

This antibody has been engineered to specifically recognize the recombinant protein COL1A2 using the following amino acid sequence: GPPGVSGGGYDFGYDGDFYRADQPRSAPSLRPKDYEV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for COL1A2 Antibody - BSA Free

COL1A2 Antibody Immunocytochemistry/Immunofluorescence: COL1A2 Antibody [NBP3-24756]

Immunocytochemistry/Immunofluorescence: COL1A2 Antibody [NBP3-24756]

Staining of human cell line ASC52telo shows localization to endoplasmic reticulum.

Applications for COL1A2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 µg/ml
Application Notes
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: COL1A2

The extensive family of COL gene products (collagens) is composed of several chain types, including fibril-forming interstitial collagens (types I, II, III and V) and basement membrane collagens (type IV), each type containing multiple isoforms. Collagens are fibrous, extracellular matrix proteins with high tensile strength and are the major components of connective tissue, such as tendons and cartilage. All collagens contain a triple helix domain and frequently show lateral self-association in order to form complex connective tissues. Several collagens also play a role in cell adhesion, important for maintaining normal tissue architecture and function.

Alternate Names

alpha 2(I)-collagen, Alpha-2 type I collagen, collagen alpha-2(I) chain, collagen I, alpha-2 polypeptide, collagen of skin, tendon and bone, alpha-2 chain, collagen, type I, alpha 2, OI4, osteogenesis imperfecta type IV, type I procollagen

Gene Symbol

COL1A2

Additional COL1A2 Products

Product Documents for COL1A2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for COL1A2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for COL1A2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review COL1A2 Antibody - BSA Free and earn rewards!

Have you used COL1A2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies