Collagen IV Antibody (3V3N3)

Novus Biologicals | Catalog # NBP3-33471

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Dot Blot

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 3V3N3
View all Collagen IV Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1573-1690 of human Collagen IV (NP_000083.3).

Sequence:
AQAVAVHSQDQSIPPCPQTWRSLWIGYSFLMHTGAGDQGGGQALMSPGSCLEDFRAAPFLECQGRQGTCHFFANKYSFWLTTVKADLQFSSAPAPDTLKESQAQRQKISRCQVCVKYS

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

164 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Collagen IV Antibody (3V3N3)

Collagen IV Antibody (3V3N3)

Western Blot: Collagen IV Antibody (3V3N3) [NBP3-33471] -

Western Blot: Collagen IV Antibody (3V3N3) [NBP3-33471] - Western blot analysis of lysates from HeLa cells, using Collagen IV Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 5s.
Collagen IV Antibody (3V3N3)

Dot Blot: Collagen IV Antibody (3V3N3) [NBP3-33471] -

Dot Blot: Collagen IV Antibody (3V3N3) [NBP3-33471] - Dot-blot analysis of all sorts of peptides using Collagen IV Rabbit mAb antibody at 1:1000 dilution.
Collagen IV Antibody (3V3N3)

Collagen IV Antibody (3V3N3) [NBP3-33471] -

Analysis of various lysates using Collagen IV Rabbit mAb at 1:7000 dilution incubated at room temperature for 1.5 hours.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 45 s.
Collagen IV Antibody (3V3N3)

Collagen IV Antibody (3V3N3) [NBP3-33471] -

Analysis of lysates from Mouse lung using Collagen IV Rabbit mAb at 1:7000 dilution incubated at room temperature for 1.5 hours.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 45 s.

Applications for Collagen IV Antibody (3V3N3)

Application
Recommended Usage

Dot Blot

1:500 - 1:1000

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:2000 - 1:8000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Collagen IV

Collagens comprise a large family of insoluble extracellular glycoproteins that are essential components of connective tissues such as tendons, ligaments, cartilage, bone and skin. The mature polypeptides are secreted as coiled, left-handed helices that subsequently assemble into rope-like collagen fibers. Collagen I is a fibril-forming collagen that requires N- and C- terminal processing. Collagen IV is a network forming collagen whose C-terminus forms dimers and N-terminus forms tetramers.

Alternate Names

BSVD;BSVD1;COL4A1s;Collagen alpha-1(IV) chain;PADMAL;RATOR

Gene Symbol

COL4A1

Additional Collagen IV Products

Product Documents for Collagen IV Antibody (3V3N3)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Collagen IV Antibody (3V3N3)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Collagen IV Antibody (3V3N3)

There are currently no reviews for this product. Be the first to review Collagen IV Antibody (3V3N3) and earn rewards!

Have you used Collagen IV Antibody (3V3N3)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies