Collagen VI alpha 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58879

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ELSFVFLTDGVTGNDSLHESAHSMRKQNVVPTVLALGSDVDMDVLTTLSLGDRAAVFHEKDYDSLAQPGFFDRFIR

Reactivity Notes

Mouse 86%, Rat 86%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Collagen VI alpha 2 Antibody - BSA Free

Immunohistochemistry-Paraffin: Collagen VI alpha 2 Antibody [NBP2-58879]

Immunohistochemistry-Paraffin: Collagen VI alpha 2 Antibody [NBP2-58879]

Immunohistochemistry-Paraffin: Collagen VI alpha 2 Antibody [NBP2-58879] - Staining of human prostate shows strong membranous positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: Collagen VI alpha 2 Antibody [NBP2-58879]

Immunohistochemistry-Paraffin: Collagen VI alpha 2 Antibody [NBP2-58879]

Immunohistochemistry-Paraffin: Collagen VI alpha 2 Antibody [NBP2-58879] - Staining of human colon shows strong positivity in extracellular matrix in lamina propria.
Immunohistochemistry-Paraffin: Collagen VI alpha 2 Antibody [NBP2-58879]

Immunohistochemistry-Paraffin: Collagen VI alpha 2 Antibody [NBP2-58879]

Immunohistochemistry-Paraffin: Collagen VI alpha 2 Antibody [NBP2-58879] - Staining of human gastrointestinal, pancreas, placenta and prostate using Anti-COL6A2 antibody NBP2-58879 (A) shows similar protein distribution across tissues to independent antibody NBP1-90951 (B).
Immunohistochemistry-Paraffin: Collagen VI alpha 2 Antibody [NBP2-58879]

Immunohistochemistry-Paraffin: Collagen VI alpha 2 Antibody [NBP2-58879]

Immunohistochemistry-Paraffin: Collagen VI alpha 2 Antibody [NBP2-58879] - Staining of human pancreas shows only very weak positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: Collagen VI alpha 2 Antibody [NBP2-58879]

Immunohistochemistry-Paraffin: Collagen VI alpha 2 Antibody [NBP2-58879]

Immunohistochemistry-Paraffin: Collagen VI alpha 2 Antibody [NBP2-58879] - Staining of human placenta shows strong positivity in extracellular matrix in chorionic vlli.

Applications for Collagen VI alpha 2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Collagen VI alpha 2

Collagen VI alpha 2 belongs to the type VI collagen family and acts as a cell-binding protein as well as having a role in extracellular matrix upkeep. Collagen VI alpha 2 has been studied in relation to Bethlem myopathy and Ullrich scleroatonic muscular dystrophy.

Alternate Names

collagen alpha-2(VI) chain, collagen VI, alpha-2 polypeptide, collagen, type VI, alpha 2,10PP3610, DKFZp586E1322, FLJ46862

Gene Symbol

COL6A2

Additional Collagen VI alpha 2 Products

Product Documents for Collagen VI alpha 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Collagen VI alpha 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Collagen VI alpha 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Collagen VI alpha 2 Antibody - BSA Free and earn rewards!

Have you used Collagen VI alpha 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...