Collagen VI alpha 3 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-34837
Loading...
Key Product Details
Species Reactivity
Human
Applications
Multiplex Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Simple Western
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PRDLKIVVLMLTGEVPEQQLEEAQRVILQAKCKGYFFVVLGIGRKVNIKEVYTFASEPNDVFFKLVDKSTELNEEPLMRFGRLLPSFVSSENAFYLSPDIRKQCDWFQGDQPTKNLVKFGHKQVNVPNNVTSSPTSNPVTTTKPVT
Reactivity Notes
Expected to cross react based on sequence identity: Mouse (85%).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Collagen VI alpha 3 Antibody - BSA Free
Western Blot: Collagen VI alpha 3 Antibody [NBP2-34837]
Western Blot: Collagen VI alpha 3 Antibody [NBP2-34837] - Analysis in human cell line U-87 MG.Immunohistochemistry-Paraffin: Collagen VI alpha 3 Antibody [NBP2-34837]
Immunohistochemistry-Paraffin: Collagen VI alpha 3 Antibody [NBP2-34837] - Staining of human placenta shows moderate cytoplasmic positivity in connective tissues.Immunohistochemistry-Paraffin: Collagen VI alpha 3 Antibody [NBP2-34837]
Immunohistochemistry-Paraffin: Collagen VI alpha 3 Antibody [NBP2-34837] - Staining of human ovary shows moderate cytoplasmic positivity in smooth muscle cells.Immunohistochemistry-Paraffin: Collagen VI alpha 3 Antibody [NBP2-34837]
Immunohistochemistry-Paraffin: Collagen VI alpha 3 Antibody [NBP2-34837] - Staining of human cerebral cortex shows no positivity in neurons.Simple Western: Collagen VI alpha 3 Antibody [NBP2-34837]
Simple Western: Collagen VI alpha 3 Antibody [NBP2-34837] - Lane view shows a specific band for Collagen IV alpha3 in 0.2 mg/ml of WI-38 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.Simple Western: Collagen VI alpha 3 Antibody [NBP2-34837]
Simple Western: Collagen VI alpha 3 Antibody [NBP2-34837] - Electropherogram image of the corresponding Simple Western lane view. Collagen IV alpha3 antibody was used at 1:25 dilution on WI-38 lysate(s) respectively.Applications for Collagen VI alpha 3 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:20 - 1:50
Immunohistochemistry-Paraffin
1:20 - 1:50
Simple Western
1:25
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
See Simple Western Antibody Database for Simple Western validation: Tested in WI-38 lysates, separated by Size, antibody dilution of 1:25
See Simple Western Antibody Database for Simple Western validation: Tested in WI-38 lysates, separated by Size, antibody dilution of 1:25
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Collagen VI alpha 3
Alternate Names
Collagen Alpha-3(VI) Chain, Collagen VI, Alpha-3 Polypeptide, collagen, type VI, alpha 3
Gene Symbol
COL6A3
Additional Collagen VI alpha 3 Products
Product Documents for Collagen VI alpha 3 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Collagen VI alpha 3 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Collagen VI alpha 3 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Collagen VI alpha 3 Antibody - BSA Free and earn rewards!
Have you used Collagen VI alpha 3 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...