Complement Factor B Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89985

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Mouse, Rat

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence, Simple Western

Cited:

Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGMVWEHRKGTDYHKQPWQAKISVIRPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNKLKYG

Reactivity Notes

Mouse (86%), (81%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Complement Factor B Antibody - BSA Free

Complement Factor B Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: Complement Factor B Antibody - BSA Free [NBP1-89985]

Immunocytochemistry/ Immunofluorescence: Complement Factor B Antibody - BSA Free [NBP1-89985]

Staining of human cell line ASC TERT1 shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: Complement Factor B Antibody [NBP1-89985]

Immunohistochemistry-Paraffin: Complement Factor B Antibody [NBP1-89985]

Immunohistochemistry-Paraffin: Complement Factor B Antibody [NBP1-89985] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
Complement Factor B Antibody - BSA Free Immunohistochemistry-Paraffin: Complement Factor B Antibody - BSA Free [NBP1-89985]

Immunohistochemistry-Paraffin: Complement Factor B Antibody - BSA Free [NBP1-89985]

Staining of human placenta shows strong positivity in trophoblastic cells.
Complement Factor B Antibody - BSA Free Immunohistochemistry-Paraffin: Complement Factor B Antibody - BSA Free [NBP1-89985]

Immunohistochemistry-Paraffin: Complement Factor B Antibody - BSA Free [NBP1-89985]

Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.
Complement Factor B Antibody - BSA Free Immunohistochemistry-Paraffin: Complement Factor B Antibody - BSA Free [NBP1-89985]

Immunohistochemistry-Paraffin: Complement Factor B Antibody - BSA Free [NBP1-89985]

Staining of human kidney shows moderate positivity in secretion surrounding cells in tubules.
Simple Western: Complement Factor B Antibody [NBP1-89985]

Simple Western: Complement Factor B Antibody [NBP1-89985]

Simple Western: Complement Factor B Antibody [NBP1-89985] - Simple Western lane view shows a specific band for CFB in 0.2 mg/ml of Tonsil lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Simple Western: Complement Factor B Antibody [NBP1-89985]

Simple Western: Complement Factor B Antibody [NBP1-89985]

Simple Western: Complement Factor B Antibody [NBP1-89985] - Electropherogram image(s) of corresponding Simple Western lane view. Complement Factor B antibody was used at 1:20 dilution on Tonsil lysate(s).
Complement Factor B Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Complement Factor B Antibody - BSA Free [NBP1-89985] -

The activation of mTORC1 in KCs enhances complement alternative system.a Expression heatmap of genes of neutrophils chemotaxis or complement activation analyzed by RNA-seq from Tsc1+/+ and Tsc1-/- BMMs (n = 3 each). b Western blotting result was shown the expression of CFB protein in hepatic tissues from mice. c Left, representative co-immunofluorescent staining images for F4/80 with CFB. Scale bar = 50 μm. Right, quantitative determination of F4/80+ and CFB+ cells among groups as indicated, n = 3. d Western blotting assay showing the abundance for TSC1, CFB, and p-S6 in BMMs. e qRT-PCR analysis showing the CFB mRNA abundance in BMMs, n = 3. f Western blotting assay showing the abundance for TSC1, CFB, and p-S6 in KCs. g qRT-PCR analysis showing the CFB mRNA abundance in KCs, n = 3. h Representative immunofluorescent staining images for C3d. Scale bar = 50 μm. i Representative immunostaining images for C5b-9. Scale bar = 50 μm. j Western blotting assay showing the abundance for Rheb and CFB in BMMs. k Western blotting assay showing the abundance for Rheb and CFB in KCs. l Representative co-immunofluorescent staining images for F4/80 with CFB (white arrows). Scale bar = 100 μm. m Quantitative determination of F4/80+ and CFB+ cells among groups as indicated, n = 3. n Representative immunofluorescent staining images for C3d. Scale bar = 100 μm. o Representative immunostaining images for C5b-9 among groups as indicated. Scale bar = 100 μm. *p < 0.05. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36494334), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Complement Factor B Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Complement Factor B Antibody - BSA Free [NBP1-89985] -

The activation of mTORC1 in KCs enhances complement alternative system.a Expression heatmap of genes of neutrophils chemotaxis or complement activation analyzed by RNA-seq from Tsc1+/+ and Tsc1-/- BMMs (n = 3 each). b Western blotting result was shown the expression of CFB protein in hepatic tissues from mice. c Left, representative co-immunofluorescent staining images for F4/80 with CFB. Scale bar = 50 μm. Right, quantitative determination of F4/80+ and CFB+ cells among groups as indicated, n = 3. d Western blotting assay showing the abundance for TSC1, CFB, and p-S6 in BMMs. e qRT-PCR analysis showing the CFB mRNA abundance in BMMs, n = 3. f Western blotting assay showing the abundance for TSC1, CFB, and p-S6 in KCs. g qRT-PCR analysis showing the CFB mRNA abundance in KCs, n = 3. h Representative immunofluorescent staining images for C3d. Scale bar = 50 μm. i Representative immunostaining images for C5b-9. Scale bar = 50 μm. j Western blotting assay showing the abundance for Rheb and CFB in BMMs. k Western blotting assay showing the abundance for Rheb and CFB in KCs. l Representative co-immunofluorescent staining images for F4/80 with CFB (white arrows). Scale bar = 100 μm. m Quantitative determination of F4/80+ and CFB+ cells among groups as indicated, n = 3. n Representative immunofluorescent staining images for C3d. Scale bar = 100 μm. o Representative immunostaining images for C5b-9 among groups as indicated. Scale bar = 100 μm. *p < 0.05. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36494334), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Complement Factor B Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Complement Factor B Antibody - BSA Free [NBP1-89985] -

Down regulation of CFB in liver protects against Con-A induced liver injury.a Western blotting assay showing CFB expression in mouse livers after shRNA-CFB injection. b Representative co-immunofluorescent staining images for F4/80 with CFB (white arrows). Scale bar = 100 μm. c The strategy for establishing a mouse model of injection of shRNA-CFB and Con-A administration. d The ALT levels in serum of mice exposed to Con-A for 8 h, n = 6. e Representative HE-stained mouse livers. Scale bar = 100 μm. f Liver sections of were immunofluorescent stained with TUNEL. Scale bar = 200 μm. g Left, representative immunofluorescent staining images for ly6b. Scale bar = 100 μm. Right, quantitative determination of ly6b+ cells among groups as indicated, n = 4. h Left, representative immunofluorescent staining images for C3d. Scale bar = 100 μm. Right, quantitative determination of C3d area in a field of vision, n = 4. i Representative immunostaining images for C5b-9. Scale bar = 100 μm. j Left, representative immunofluorescent staining images for F4/80 (white arrows). Scale bar = 100 μm. Right, quantitative determination of F4/80+ cells among groups as indicated, n = 4. *p < 0.05. k Schematic working model on the role of mTORC1 activation in hepatocytes and KCs in the pathogenesis of ALD. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36494334), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for Complement Factor B Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Simple Western

1:20
Application Notes

For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in Tonsil, separated by Size, antibody dilution of 1:20, apparent MW was 120 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Complement Factor B

Complement factor B is a component of the alternative pathway of complement activation. Factor B circulates in the blood as a single chain polypeptide. Upon activation of the alternative pathway, it is cleaved by complement factor D yielding the noncatalytic chain Ba and the catalytic subunit Bb. The active subunit Bb is a serine protease that associates with C3b to form the alternative pathway C3 convertase. Bb is involved in the proliferation of preactivated B lymphocytes, while Ba inhibits their proliferation. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. This cluster includes several genes involved in regulation of the immune reaction. The polyadenylation site of this gene is 421 bp from the 5' end of the gene for complement component 2.

Alternate Names

BF, BFD, C3/C5 convertase, CFAB, CFB, GBG, H2-Bf, PBF2

Gene Symbol

CFB

Additional Complement Factor B Products

Product Documents for Complement Factor B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Complement Factor B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Complement Factor B Antibody - BSA Free

Customer Reviews for Complement Factor B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Complement Factor B Antibody - BSA Free and earn rewards!

Have you used Complement Factor B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...