Connexin 30.1/GJB5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84333

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Connexin 30.1/GJB5 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KRCHECLAARKAQAMCTGHHPHGTTSSCKQDDLLSGDLIFLGSDSHPPLLPDRPRDHVKK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Connexin 30.1/GJB5 Antibody - BSA Free

Connexin 30.1/GJB5 Antibody - BSA Free Immunohistochemistry-Paraffin: Connexin 30.1/GJB5 Antibody - BSA Free [NBP1-84333]

Immunohistochemistry-Paraffin: Connexin 30.1/GJB5 Antibody - BSA Free [NBP1-84333]

Staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.
Connexin 30.1/GJB5 Antibody - BSA Free Immunohistochemistry-Paraffin: Connexin 30.1/GJB5 Antibody - BSA Free [NBP1-84333]

Immunohistochemistry-Paraffin: Connexin 30.1/GJB5 Antibody - BSA Free [NBP1-84333]

Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
Connexin 30.1/GJB5 Antibody - BSA Free Western Blot: Connexin 30.1/GJB5 Antibody - BSA Free [NBP1-84333]

Western Blot: Connexin 30.1/GJB5 Antibody - BSA Free [NBP1-84333]

Analysis in human cell line RT-4.
Connexin 30.1/GJB5 Antibody - BSA Free Immunohistochemistry-Paraffin: Connexin 30.1/GJB5 Antibody - BSA Free [NBP1-84333]

Immunohistochemistry-Paraffin: Connexin 30.1/GJB5 Antibody - BSA Free [NBP1-84333]

Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Connexin 30.1/GJB5 Antibody - BSA Free Immunohistochemistry-Paraffin: Connexin 30.1/GJB5 Antibody - BSA Free [NBP1-84333]

Immunohistochemistry-Paraffin: Connexin 30.1/GJB5 Antibody - BSA Free [NBP1-84333]

Staining of human endometrium shows negative positivity in glandular cells.

Applications for Connexin 30.1/GJB5 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Connexin 30.1/GJB5

GJB5, also known as Gap junction beta-5 protein, is a 273 amino acid protein that is 31 kDa. A gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, that provide direct intracellular communication. Current research is being performed on this proteins involvement in erythrokeratodermia variabilis, peripheral neuropathy, neuropathy, neuronitis, erythrokeratoderma, and hearing loss. This protein has been linked to signaling in Gap junctions pathway and interacting GSK3B protein.

Alternate Names

CX31.1, GJB5

Gene Symbol

GJB5

Additional Connexin 30.1/GJB5 Products

Product Documents for Connexin 30.1/GJB5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Connexin 30.1/GJB5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Ion Channels and Regulators

Citations for Connexin 30.1/GJB5 Antibody - BSA Free

Customer Reviews for Connexin 30.1/GJB5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Connexin 30.1/GJB5 Antibody - BSA Free and earn rewards!

Have you used Connexin 30.1/GJB5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies