Contactin-6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91804

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: TQEPHDVIFPLDLSKSEVILNCAANGYPSPHYRWKQNGTDIDFTMSYHYRLDGGSLAINSPHTDQDIGMYQCLATNLLGTILSRKAKLQF

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (84%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Contactin-6 Antibody - BSA Free

Immunohistochemistry-Paraffin: Contactin-6 Antibody [NBP1-91804]

Immunohistochemistry-Paraffin: Contactin-6 Antibody [NBP1-91804]

Immunohistochemistry-Paraffin: Contactin-6 Antibody [NBP1-91804] - Staining of human thyroid gland shows cytoplasmic positivity in glandular cells.

Applications for Contactin-6 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Contactin-6

The neural adhesion molecule Contactin-6, also known as NB-3, is a contactin/F3 subgroup member of immunoglobulin superfamily. It is expressed exclusively in the nervous system and mainly upregulated at the early postnatal stage during mouse brain development. Employing Northern blot analysis Kamei et al found that amongst different regions of the adult human nervous system cerebellum expressed highest level of NB-3 mRNA. The expression of NB-3 in the cerebellum increases until adulthood. In contrast, the expression in the cerebrum declines to a low level after postnatal day 7. NB-3 like other neural recognition molecules plays a vitally important role in axonal guidance during development, plasticity, and maintenance of synaptic connections in the adult brain. Cui et al recently showed that NB-3 acts as a novel Notch ligand to participate in oligodendrocyte generation. Furthermore, NB-3 triggers nuclear translocation of the Notch intracellular domain and promotes oligodendrogliogenesis from progenitor cells and differentiation of oligodendrocyte precursor cells via Deltex1. In primary oligodendrocytes, NB-3 increases myelin-associated glycoprotein transcripts. Hence, the NB-3/Notch signaling pathway may be worthwhile a closer examination for its potential for the treatment of demyelinating diseases. Human NB-3 shares with rat NB-3 86% identity in nucleotide sequences and 90% identity in amino acid sequences. FUNCTION: Contactins mediate cell surface interactions during nervous system development. Participates in oligodendrocytes generation by acting as a ligand of NOTCH1. Its association with NOTCH1 promotes NOTCH1 activation through the released notch intracellular domain (NICD) and subsequent translocation to the nucleus. Involved in motor coordination. SUBCELLULAR LOCATION: Cell membrane; lipid-anchor; GPI-anchor. ALTERNATIVE PRODUCTS: 2 named isoforms produced by alternative splicing. TISSUE SPECIFICITY: Expressed in brain. In brain, it is preferentially expressed in the accessory olfactory bulb, layers II/III and V of the cerebral cortex, piriform cortex, anterior thalamic nuclei, locus coeruleus of the pons and mesencephalic trigeminal nucleus and in Purkinje cells of the cerebellum. DEVELOPMENTAL STAGE: Highly expressed after birth, reaching a maximum at the postnatal day 7, and declines thereafter in the cerebrum, whereas it increases in the cerebellum to adulthood. MISCELLANEOUS: Mice lacking CNTN6 are viable and fertile, the formation and organization of all nuclei and layers throughout the brains are apparently normal. They are however slow to learn to stay on the rotating rod in the rotorod test during repeated trials, and display dysfunction of equilibrium and vestibular senses in the wire hang and horizontal rod-walking tests. SIMILARITY: Belongs to the immunoglobulin superfamily. Contactin family. SIMILARITY: Contains 4 fibronectin type-III domains. SIMILARITY: Contains 6 Ig-like C2-type (immunoglobulin-like) domains.

Alternate Names

CNTN6, Contactin6, NB3

Gene Symbol

CNTN6

Additional Contactin-6 Products

Product Documents for Contactin-6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Contactin-6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Contactin-6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Contactin-6 Antibody - BSA Free and earn rewards!

Have you used Contactin-6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

Notch Signaling Pathways
Notch Signaling Pathway Thumbnail