COPS8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35268

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all COPS8 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-209 of human COPS8 (NP_006701.1).

Sequence:
MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLEN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for COPS8 Antibody - BSA Free

COPS8 Antibody

Western Blot: COPS8 Antibody [NBP3-35268] -

Western Blot: COPS8 Antibody [NBP3-35268] - Western blot analysis of various lysates using COPS8 Rabbit pAb at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
COPS8 Antibody

Immunocytochemistry/ Immunofluorescence: COPS8 Antibody [NBP3-35268] -

Immunocytochemistry/ Immunofluorescence: COPS8 Antibody [NBP3-35268] - Immunofluorescence analysis of U2OS cells using COPS8 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
COPS8 Antibody

Immunocytochemistry/ Immunofluorescence: COPS8 Antibody [NBP3-35268] -

Immunocytochemistry/ Immunofluorescence: COPS8 Antibody [NBP3-35268] - Immunofluorescence analysis of H9C2 cells using COPS8 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
COPS8 Antibody

Immunocytochemistry/ Immunofluorescence: COPS8 Antibody [NBP3-35268] -

Immunocytochemistry/ Immunofluorescence: COPS8 Antibody [NBP3-35268] - Immunofluorescence analysis of L929 cells using COPS8 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for COPS8 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: COPS8

COPS8 is encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. Alternatively spliced transcript variants encoding distinct isoforms have been observed.

Alternate Names

COP9, COP9 constitutive photomorphogenic homolog subunit 8 (Arabidopsis), COP9 homolog, COP9 signalosome complex subunit 8, CSN8JAB1-containing signalosome subunit 8, hCOP9, MGC1297, MMMEP, SGN8MGC43256, Signalosome subunit 8

Gene Symbol

COPS8

Additional COPS8 Products

Product Documents for COPS8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for COPS8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for COPS8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review COPS8 Antibody - BSA Free and earn rewards!

Have you used COPS8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies