Cortactin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38826

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (96%), Rat (97%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Cortactin Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: GFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQDSAAVGFDYKEKLAKHESQQDYSKGF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Cortactin Antibody - BSA Free

Western Blot: Cortactin Antibody [NBP2-38826]

Western Blot: Cortactin Antibody [NBP2-38826]

Western Blot: Cortactin Antibody [NBP2-38826] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human Adrenal Gland tissue
Immunocytochemistry/ Immunofluorescence: Cortactin Antibody [NBP2-38826]

Immunocytochemistry/ Immunofluorescence: Cortactin Antibody [NBP2-38826]

Immunocytochemistry/Immunofluorescence: Cortactin Antibody [NBP2-38826] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & vesicles. Antibody staining is shown in green.
Cortactin Antibody

Immunohistochemistry-Paraffin: Cortactin Antibody [NBP2-38826] -

Immunohistochemistry-Paraffin: Cortactin Antibody [NBP2-38826] - Staining of human Rectum shows moderate membranous and cytoplasmic positivity in glandular cells.

Applications for Cortactin Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cortactin

Immunocytochemistry reveals that in epithelial cells, the human cortactin protein is localized mainly in the cytoplasm and, to a very low extent, in protruding leading lamellae of the cell. However, in carcinoma cells that constitutively overexpress cortactin accumulates in the podosome-like adherens junctions associated with the cell-substratum contact sites. Overexpression and concomitant accumulation of the Cortactin protein in the cell-substratum contact sites might, therefore, contribute to the invasive potential of these tumor cells (1). In cells derived from breast carcinomas and squamous carcinomas of the head and neck, DNA amplification of a particular tyrosine kinase substrate region results in overexpression of cortactin. Overexpression is accompanied by a partial redistribution of cortactin from the cytoplasm into cell-matrix contact sites (2).

Alternate Names

Amplaxin, CTTN, EMS1

Gene Symbol

CTTN

UniProt

Q14247 (Human)

Additional Cortactin Products

Product Documents for Cortactin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Cortactin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Cortactin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Cortactin Antibody - BSA Free and earn rewards!

Have you used Cortactin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies