COX17 Antibody (1A9) - Azide and BSA Free

Novus Biologicals | Catalog # H00010063-M03

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 1A9

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

COX17 (NP_005685, 1 a.a. ~ 63 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALGFKI

Specificity

COX17 - COX17 homolog, cytochrome c oxidase assembly protein (yeast) (1A9)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for COX17 Antibody (1A9) - Azide and BSA Free

Sandwich ELISA: COX17 Antibody (1A9) [H00010063-M03] - Detection limit for recombinant GST tagged COX17 is approximately 0.03ng/ml as a capture antibody.

Applications for COX17 Antibody (1A9) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: COX17

Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be involved in the recruitment of copper to mitochondria for incorporation into the COX apoenzyme. This protein shares 92% amino acid sequence identity with mouse and rat Cox17 proteins. This gene is no longer considered to be a candidate gene for COX deficiency. A pseudogene COX17P has been found on chromosome 13. [provided by RefSeq]

Alternate Names

COX17 (yeast) homolog, cytochrome c oxidase assembly protein, COX17 cytochrome c oxidase assembly homolog (S. cerevisiae), cytochrome c oxidase assembly protein (S. cerevisiae), cytochrome c oxidase assembly protein (yeast), cytochrome c oxidase copper chaperone, human homolog of yeast mitochondrial copper recruitment, MGC104397, MGC117386

Entrez Gene IDs

10063 (Human)

Gene Symbol

COX17

Additional COX17 Products

Product Documents for COX17 Antibody (1A9) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for COX17 Antibody (1A9) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for COX17 Antibody (1A9) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review COX17 Antibody (1A9) - Azide and BSA Free and earn rewards!

Have you used COX17 Antibody (1A9) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...