CPA5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91807

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (92%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CPA5 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SLPVDMRVPFSELKDIKAYLESHGLAYSIMIKDIQVLLDEERQAMAKSRRLERSTNSFSYSSYHT

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (86%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CPA5 Antibody - BSA Free

Western Blot: CPA5 Antibody [NBP1-91807]

Western Blot: CPA5 Antibody [NBP1-91807]

Western Blot: CPA5 Antibody [NBP1-91807] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: CPA5 Antibody [NBP1-91807]

Immunocytochemistry/ Immunofluorescence: CPA5 Antibody [NBP1-91807]

Immunocytochemistry/Immunofluorescence: CPA5 Antibody [NBP1-91807] - Staining of human cell line RH-30 shows localization to nucleus. Antibody staining is shown in green.
CPA5 Antibody - BSA Free Western Blot: CPA5 Antibody - BSA Free [NBP1-91807]

Western Blot: CPA5 Antibody - BSA Free [NBP1-91807]

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4

Applications for CPA5 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CPA5

Carboxypeptidases have functions ranging from digestion of food to selective biosynthesis of neuroendocrine peptides. Members of the A/B subfamily of carboxypeptidases, such as CPA5, contain an approximately 90-amino acid pro region that assists in the folding of the active carboxypeptidase domain. Cleavage of the pro region activates the enzyme (Wei et al., 2002 [PubMed 11836249]).[supplied by OMIM]

Alternate Names

carboxypeptidase A5, EC 3.4.17, EC 3.4.17.1, FLJ35969

Gene Symbol

CPA5

Additional CPA5 Products

Product Documents for CPA5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CPA5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CPA5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CPA5 Antibody - BSA Free and earn rewards!

Have you used CPA5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies