CPSF6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57541

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CPSF6 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to CPSF6 (cleavage and polyadenylation specific factor 6, 68kDa) The peptide sequence was selected from the middle region of CPSF6. Peptide sequence PPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPP. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CPSF6 Antibody - BSA Free

Western Blot: CPSF6 Antibody [NBP1-57541]

Western Blot: CPSF6 Antibody [NBP1-57541]

Western Blot: CPSF6 Antibody [NBP1-57541] - Jurkat cell lysate, Antibody Titration: 0.3125ug/ml
Immunocytochemistry/ Immunofluorescence: CPSF6 Antibody [NBP1-57541]

Immunocytochemistry/ Immunofluorescence: CPSF6 Antibody [NBP1-57541]

Immunocytochemistry/Immunofluorescence: CPSF6 Antibody [NBP1-57541] - SKOV3 Primary Antibody Dilution: 4 ug/ml Secondary Antibody : Anti-rabbit Alexa 546 Secondary Antibody Dilution: 2 ug/ml
Immunohistochemistry-Paraffin: CPSF6 Antibody [NBP1-57541]

Immunohistochemistry-Paraffin: CPSF6 Antibody [NBP1-57541]

Immunohistochemistry-Paraffin: CPSF6 Antibody [NBP1-57541] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.

Applications for CPSF6 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CPSF6

CPSF6 is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitement of other processing factors. The cleavage factor complex is composed of four polypeptides.The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitement of other processing factors. The cleavage factor complex is composed of four polypeptides. This gene encodes the 68kD subunit. It has a domain organization reminiscent of spliceosomal proteins.

Alternate Names

CFIM, CFIm68, CFIM68CPSF 68 kDa subunit, CFIMcleavage and polyadenylation specific factor 6, 68kD subunit, cleavage and polyadenylation specific factor 6, 68kDa, Cleavage and polyadenylation specificity factor 68 kDa subunit, cleavage and polyadenylation specificity factor subunit 6, HPBRII-4, HPBRII-7, pre-mRNA cleavage factor I, 68kD subunit, pre-mRNA cleavage factor Im (68kD), Pre-mRNA cleavage factor Im 68 kDa subunit, Protein HPBRII-4/7

Gene Symbol

CPSF6

Additional CPSF6 Products

Product Documents for CPSF6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CPSF6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CPSF6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CPSF6 Antibody - BSA Free and earn rewards!

Have you used CPSF6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies