CRB1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56113

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LLLALENSTYQYIRVWLERGRLAMLTPNSPKLVVKFVLNDGNVHLISLKIKPYKIELYQSSQNLGFISASTWKIEKGDV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CRB1 Antibody - BSA Free

Immunohistochemistry-Paraffin: CRB1 Antibody [NBP2-56113]

Immunohistochemistry-Paraffin: CRB1 Antibody [NBP2-56113]

Immunohistochemistry-Paraffin: CRB1 Antibody [NBP2-56113] - Staining of human retina shows cytoplasmic positivity in all layers of retina.
CRB1 Antibody CRB1 Antibody

CRB1 Antibody [NBP2-56113] -Staining of human testis shows strong cytoplasmic positivity in Leydig cells.

CRB1 Antibody [NBP2-56113] -Staining of human testis shows strong cytoplasmic positivity in Leydig cells.
CRB1 Antibody CRB1 Antibody

CRB1 Antibody [NBP2-56113] -Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

CRB1 Antibody [NBP2-56113] -Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
CRB1 Antibody CRB1 Antibody

CRB1 Antibody [NBP2-56113] - Staining of human duodenum shows negative cytoplasmic positivity in glandular cells as expected.

CRB1 Antibody [NBP2-56113] - Staining of human duodenum shows negative cytoplasmic positivity in glandular cells as expected.
CRB1 Antibody CRB1 Antibody

CRB1 Antibody [NBP2-56113] -Staining of human placenta shows negative cytoplasmic positivity in trophoblastic cells as expected.

CRB1 Antibody [NBP2-56113] -Staining of human placenta shows negative cytoplasmic positivity in trophoblastic cells as expected.

Applications for CRB1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CRB1

CRB1, also known as Protein crumbs homolog 1, contains several isoforms that are 154 kDa, 151 kDa, 142 kDa, 104 kDa, and 95 kDa, and is involved in the development of photoreceptors in the retina. Defects and mutations in the CRB1 protein result in a variety of disorders, and more research is currently being conducted on the protein's relation to other diseases, including pigmented paravenous chorioretinal atrophy, cone-rod dystrophy, Stargardt disease, keratoconus, retinal degeneration, hyperopia, tuberous sclerosis, and blindness. The protein is linked to epithelial tight junction pathways, and interacts with INADL, MPP5, PSMD13, PRKAR1A, and DDX56.

Alternate Names

crumbs homolog 1 (Drosophila), LCA8

Gene Symbol

CRB1

Additional CRB1 Products

Product Documents for CRB1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CRB1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CRB1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CRB1 Antibody - BSA Free and earn rewards!

Have you used CRB1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...