CRCP Antibody (0I6F10)

Novus Biologicals | Catalog # NBP3-33287

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 0I6F10
View all CRCP Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CRCP (NP_001035737.1).

Sequence:
MEVKDANSALLSNYEVFQLLTDLKEQRKESGKNKHSSGQQNLNTITYETLKYISKTPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLM

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CRCP Antibody (0I6F10)

CRCP Antibody (0I6F10)

Western Blot: CRCP Antibody (0I6F10) [NBP3-33287] -

Western Blot: CRCP Antibody (0I6F10) [NBP3-33287] - Western blot analysis of various lysates using CRCP Rabbit mAb at1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 3s.

Applications for CRCP Antibody (0I6F10)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CRCP

CRCP, also known as DNA-directed RNA polymerase III subunit RPC9, is a 17 kDa 148 amino acid protein with three shorter isoforms. The primary function of CRCP is to encode a protein which plays a role in increasing intracellular cAMP levels. CRCP is currently being studied in relation to cystic fibrosis, cryptorchidism, fibrosis, pancreatic cancer and pancreatitis. CRCP has been linked to the cellular localization, acrosome reaction, vasodilation, pathogenesis and parturition pathways where it interacts with POLD3, CHRAC1, VAV2, CALCRL and POLR3H.

Alternate Names

Calcitonin gene-related peptide-receptor component protein, CGRP receptor component, CGRPRCP, CGRP-RCPRNA polymerase III subunit C9, CGRP-receptor component protein, DNA-directed RNA polymerase III subunit RPC9, HsC17, RCP9, RCPMGC111194

Gene Symbol

CRCP

Additional CRCP Products

Product Documents for CRCP Antibody (0I6F10)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CRCP Antibody (0I6F10)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CRCP Antibody (0I6F10)

There are currently no reviews for this product. Be the first to review CRCP Antibody (0I6F10) and earn rewards!

Have you used CRCP Antibody (0I6F10)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies