CREB Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-90364

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Human, Rat

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western, Chromatin Immunoprecipitation-exo-Seq

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CREB Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: STIAESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDGVQG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit CREB Antibody - BSA Free (NBP1-90364) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and Simple Western. Anti-CREB Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for CREB Antibody - BSA Free

CREB Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: CREB Antibody - BSA Free [NBP1-90364]

Immunocytochemistry/ Immunofluorescence: CREB Antibody - BSA Free [NBP1-90364]

Staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: CREB Antibody [NBP1-90364]

Immunohistochemistry-Paraffin: CREB Antibody [NBP1-90364]

Immunohistochemistry-Paraffin: CREB Antibody [NBP1-90364] - Staining of human small intestine shows strong nuclear positivity in glandular cells.
CREB Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: CREB Antibody - BSA Free [NBP1-90364]

Chromatin Immunoprecipitation-exo-Seq: CREB Antibody - BSA Free [NBP1-90364]

ChIP-Exo-Seq composite graph for Anti-CREB1 (NBP1-90364) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.
CREB Antibody - BSA Free Western Blot: CREB Antibody - BSA Free [NBP1-90364]

Western Blot: CREB Antibody - BSA Free [NBP1-90364]

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
CREB Antibody - BSA Free Western Blot: CREB Antibody - BSA Free [NBP1-90364]

Western Blot: CREB Antibody - BSA Free [NBP1-90364]

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Simple Western: CREB Antibody [NBP1-90364]

Simple Western: CREB Antibody [NBP1-90364]

Simple Western: CREB Antibody [NBP1-90364] - Human foreskin cell lysate. CREB antibody dilution of 1:50. Protein concentration is 750 ug/mL. Detection is chemiluminescence. Simple Western image submitted by a verified customer review.
Simple Western: CREB Antibody [NBP1-90364]

Simple Western: CREB Antibody [NBP1-90364]

Simple Western: CREB Antibody [NBP1-90364] - Detection of CREB by Simple Western (JESS) in reconstructed human epidermis lysate (about 600 ug/mL protein concentration). Antibody at 1:50. Simple Western image submitted by a verified customer review.
CREB Antibody - BSA Free

Western Blot: CREB Antibody - BSA Free [NBP1-90364] -

The effects of perampanel (PER) and GYKI 52,466 (GYKI) on total Ca2+/cAMP response element-binding protein (CREB) and its S133 phosphorylation in chronic epilepsy rats. Both AMPAR antagonists reduce CREB S133 phosphorylation in responders (Resp), but not non-responders (Non-Resp). (A) Representative images for Western blot of CREB and p-CREB levels in the hippocampal tissues. (B–F) Quantifications of CREB (B), p-CREB S133 (C), and p-CREB S133 ratio (D) levels in the hippocampal tissues. Open circles indicate each individual value. Horizontal bars indicate mean value. Error bars indicate SEM (*, # p < 0.05 vs. control and vehicle (Veh)-treated animals, respectively; one-way ANOVA with post hoc Bonferroni’s multiple comparison). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/33348808), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for CREB Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Simple Western

1:50

Western Blot

0.04-0.4 ug/ml
Application Notes

For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
See Simple Western Antibody Database for Simple Western validation: Tested in Human foreskin cell lysate, human epidermis lysate, separated by Size, antibody dilution of 1:50

Reviewed Applications

Read 3 reviews rated 4.7 using NBP1-90364 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CREB

CREB (cAMP responsive element binding protein 1) stimulates transcription. CREB is involved in learning and memory. This protein is known to have interactions with HIST1H3B, HIST1h3A, HIST1H3C, HIST1H3D and HIST1H3E. CREB has been studied in relation to several diseases and disorders including Rubinstein-Taybi syndrome, Alzheimer's disease, leukemia and brain disease.

Long Name

cAMP Response Element-binding Protein

Alternate Names

CREB1

Gene Symbol

CREB1

Additional CREB Products

Product Documents for CREB Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CREB Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for CREB Antibody - BSA Free

Customer Reviews for CREB Antibody - BSA Free (3)

4.7 out of 5
3 Customer Ratings
5 Stars
67%
4 Stars
33%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used CREB Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 3 of 3 reviews Showing All
Filter By:
Clear Filters X
  • CREB Antibody
    Name: Anonymous
    Application: Western Blot
    Sample Tested: Endothelial
    Species: Mouse
    Verified Customer | Posted 10/11/2019
    CREB Antibody - BSA Free NBP1-90364
  • CREB Antibody
    Name: Agnès Tessier
    Application: Simple Western
    Sample Tested: Human foreskin, adult ski, engineered human skin, keratinocytes, HaCaT cells
    Species: Human
    Verified Customer | Posted 06/17/2019
    Detection of CREB by Simple Western (JESS) in reconstructed human epidermis lysate (about 600 ug/mL protein concentration). Antibody dilution: 1/50
    CREB Antibody - BSA Free NBP1-90364
  • CREB Antibody
    Name: Irini Dijkhoff
    Application: Simple Western
    Sample Tested: Human foreskin, adult ski, engineered human skin, keratinocytes, HaCaT cells
    Species: Human
    Verified Customer | Posted 05/24/2019
    CREB antibody dilution of 1:50. Protein concentration is 750 ug/mL. Detection is chemiluminescence.
    JESS default run settings.
    CREB Antibody - BSA Free NBP1-90364

There are no reviews that match your criteria.

Showing  1 - 3 of 3 reviews Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CREB Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: May I know which creb1 antibody is good for ChIP? I found a paper using your rabbit polyclonal creb1 antibody for ChIP but they didn't indicate the catalog number.

    A: We are not aware of any of our Creb1 antibodies being used in ChIP at this time. If you can provide us with the PMID of the paper you are referring to I can contact the author. Otherwise, you can use our Innovators Reward Program to try an antibody in a novel species and application.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies