CrkL is a widely-expressed 39 kD adaptor protein that belongs to the Crk protein family and is abundantly expressed in cells of hematopoetic origin. Through its SH2 and SH3 domains CrkL initiates interactions with numerous downstream proteins such as CBL, Cas, Paxillin, C3G, SOS, PI3K, c-Abl and BCR/Abl. It is involved in processes such as adhesion, migration and immune responses. Furthermore, CrkL plays an essential role in Chronic Myelogenous Leukemia and is constitutively phosphorylated by the Bcr-Abl kinase in this disease.
![CrkL Antibody - BSA Free Western Blot: CrkL Antibody - BSA Free [NBP1-86181]](https://resources.rndsystems.com/images/products/nbp1-86181_rabbit-polyclonal-crkl-antibody-23420251592558.jpg "Western Blot: CrkL Antibody - BSA Free [NBP1-86181]")
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Predicted:
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: LEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEKLVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPDE
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for CrkL Antibody - BSA Free
Western Blot: CrkL Antibody - BSA Free [NBP1-86181]
Analysis in human cell line K562.![CrkL Antibody - BSA Free Immunohistochemistry-Paraffin: CrkL Antibody - BSA Free [NBP1-86181]](https://resources.rndsystems.com/images/products/nbp1-86181_rabbit-polyclonal-crkl-antibody-23420251592592.jpg "Immunohistochemistry-Paraffin: CrkL Antibody - BSA Free [NBP1-86181]")
Immunohistochemistry-Paraffin: CrkL Antibody - BSA Free [NBP1-86181]
Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.![CrkL Antibody - BSA Free Immunohistochemistry-Paraffin: CrkL Antibody - BSA Free [NBP1-86181]](https://resources.rndsystems.com/images/products/nbp1-86181_rabbit-polyclonal-crkl-antibody-23420251562092.jpg "Immunohistochemistry-Paraffin: CrkL Antibody - BSA Free [NBP1-86181]")
Immunohistochemistry-Paraffin: CrkL Antibody - BSA Free [NBP1-86181]
Staining of human pancreas shows no positivity in exocrine glandular cells as expected.![CrkL Antibody - BSA Free Immunohistochemistry-Paraffin: CrkL Antibody - BSA Free [NBP1-86181]](https://resources.rndsystems.com/images/products/nbp1-86181_rabbit-polyclonal-crkl-antibody-23420251592526.jpg "Immunohistochemistry-Paraffin: CrkL Antibody - BSA Free [NBP1-86181]")
Immunohistochemistry-Paraffin: CrkL Antibody - BSA Free [NBP1-86181]
Staining of human liver shows no positivity in hepatocytes as expected.![CrkL Antibody - BSA Free Immunohistochemistry-Paraffin: CrkL Antibody - BSA Free [NBP1-86181]](https://resources.rndsystems.com/images/products/nbp1-86181_rabbit-polyclonal-crkl-antibody-24420259342971.jpg "Immunohistochemistry-Paraffin: CrkL Antibody - BSA Free [NBP1-86181]")
Immunohistochemistry-Paraffin: CrkL Antibody - BSA Free [NBP1-86181]
Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.Applications for CrkL Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:20 - 1:50
Immunohistochemistry-Paraffin
1:20 - 1:50
Western Blot
0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: CrkL
Long Name
V-Crk Sarcoma Virus CT10 Oncogene Homolog-like Protein
Alternate Names
crk-like protein, pCRKL, v-crk avian sarcoma virus CT10 oncogene homolog-like, v-crk sarcoma virus CT10 oncogene homolog (avian)-like
Gene Symbol
CRKL
Additional CrkL Products
Product Documents for CrkL Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for CrkL Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for CrkL Antibody - BSA Free
There are currently no reviews for this product. Be the first to review CrkL Antibody - BSA Free and earn rewards!
Have you used CrkL Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...