CSAD Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35392

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CSAD Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 371-520 of human CSAD (NP_057073.4).

Sequence:
DVALDTGDKVVQCGRRVDCLKLWLMWKAQGDQGLERRIDQAFVLARYLVEEMKKREGFELVMEPEFVNVCFWFVPPSLRGKQESPDYHERLSKVAPVLKERMVKEGSMMIGYQPHGTRGNFFRVVVANSALTCADMDFLLNELERLGQDL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CSAD Antibody - BSA Free

CSAD Antibody

Western Blot: CSAD Antibody [NBP3-35392] -

Western Blot: CSAD Antibody [NBP3-35392] - Western blot analysis of various lysates using CSAD Rabbit pAb at 1:5000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
CSAD Antibody

Western Blot: CSAD Antibody [NBP3-35392] -

Western Blot: CSAD Antibody [NBP3-35392] - Western blot analysis of various lysates using CSAD Rabbit pAb at 1:5000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.

Applications for CSAD Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:2000 - 1:6000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CSAD

CSAD, also known as Cysteine sulfinic acid decarboxylase-related protein, consists of a 582 amino acid isoform that is 64 kDa, and is involved in the process through which cysteinesulfinate undergoes decarboxylation to produce hypotaurine. Current research is being conducted on CSAD to determine its relation to several diseases and disorders, including pulmonary edema, stiff-person syndrome, hepatocellular carcinoma, prostate cancer, seizures, and autoimmune diseases. CSAD interacts with SMN1, SMN2, ANXA1, ANXA7, and CDKN1A in several metabolic pathways and taurine biosynthesis.

Alternate Names

CSDMGC119355, cysteine sulfinic acid decarboxylase, Cysteine-sulfinate decarboxylase, EC 4.1.1, EC 4.1.1.29, FLJ44987, FLJ45500, MGC119354, MGC119357, PCAP, P-selectin cytoplasmic tail-associated protein, Sulfinoalanine decarboxylase

Gene Symbol

CSAD

Additional CSAD Products

Product Documents for CSAD Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CSAD Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CSAD Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CSAD Antibody - BSA Free and earn rewards!

Have you used CSAD Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies