CSDE1 Antibody (1N9F6)

Novus Biologicals | Catalog # NBP3-33278

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 1N9F6
View all CSDE1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CSDE1 (NP_009089.4).

Sequence:
MSFDPNLLHNNGHNGYPNGTSAALRETGVIEKLLTSYGFIQCSERQARLFFHCSQYNGNLQDLKVGDDVEFEVSSDRRTGKPIAVKLVKIKQEILPEERM

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

89 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CSDE1 Antibody (1N9F6)

CSDE1 Antibody (1N9F6)

Western Blot: CSDE1 Antibody (1N9F6) [NBP3-33278] -

Western Blot: CSDE1 Antibody (1N9F6) [NBP3-33278] - Western blot analysis of lysates from Mouse skeletal muscle, using CSDE1 Rabbit mAb at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 180s.
CSDE1 Antibody (1N9F6)

Western Blot: CSDE1 Antibody (1N9F6) [NBP3-33278] -

Western Blot: CSDE1 Antibody (1N9F6) [NBP3-33278] - Western blot analysis of various lysates using CSDE1 Rabbit mAb at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.

Applications for CSDE1 Antibody (1N9F6)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CSDE1

CSDE1, also known as Cold shock domain-containing protein E1, is a 798 amino acid long isoform that is 89 kDa and a short 767 amino acid isoform that is approx. 86 kDa, which is directly related to the translation of the human rhinovirus RNA as an RNA binding protein. Studies are being performed on the relationship of this protein to chronic lymphocytic leukemia, diamond-blackfan anemia, lymphocytic leukemia, breast cancer, and shock. CSDE1 protein involvement has been observed with relation to PCSK7, SYNCRIP, PABPC1, HNRNPD, PIK3R1 in the regulation of transcription DNA-dependent and male gonad development pathways.

Alternate Names

cold shock domain containing E1, RNA-binding, cold shock domain-containing protein E1, D1S155EUNRRP5-1000E10.3, DKFZp779B0247, DKFZp779J1455, FLJ26882, KIAA0885, N-ras upstream gene protein, NRAS-related, NRU, Protein UNR, upstream of NRAS

Gene Symbol

CSDE1

Additional CSDE1 Products

Product Documents for CSDE1 Antibody (1N9F6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CSDE1 Antibody (1N9F6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CSDE1 Antibody (1N9F6)

There are currently no reviews for this product. Be the first to review CSDE1 Antibody (1N9F6) and earn rewards!

Have you used CSDE1 Antibody (1N9F6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies