CSK Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-85951
![Immunocytochemistry/ Immunofluorescence: CSK Antibody [NBP1-85951]](https://resources.rndsystems.com/images/products/CSK-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85951-img0009.jpg "Immunocytochemistry/ Immunofluorescence: CSK Antibody [NBP1-85951]")
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: WSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMKNCWHLDAAMRPSFLQLREQLEHIKTHELH
Reactivity Notes
Reactivity reported in scientific literature (PMID: 22665063)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for CSK Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: CSK Antibody [NBP1-85951]
Immunocytochemistry/Immunofluorescence: CSK Antibody [NBP1-85951] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & vesicles.![Western Blot: CSK Antibody [NBP1-85951]](https://resources.rndsystems.com/images/products/CSK-Antibody-Western-Blot-NBP1-85951-img0010.jpg "Western Blot: CSK Antibody [NBP1-85951]")
Western Blot: CSK Antibody [NBP1-85951]
Western Blot: CSK Antibody [NBP1-85951] - Analysis in human cell line RT-4 and human cell line HeLa.![CSK Antibody - BSA Free Western Blot: CSK Antibody - BSA Free [NBP1-85951]](https://resources.rndsystems.com/images/products/nbp1-85951_rabbit-polyclonal-csk-antibody-2442025930884.jpg "Western Blot: CSK Antibody - BSA Free [NBP1-85951]")
Western Blot: CSK Antibody - BSA Free [NBP1-85951]
Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.![Immunohistochemistry-Paraffin: CSK Antibody [NBP1-85951]](https://resources.rndsystems.com/images/products/CSK-Antibody-Immunohistochemistry-Paraffin-NBP1-85951-img0013.jpg "Immunohistochemistry-Paraffin: CSK Antibody [NBP1-85951]")
Immunohistochemistry-Paraffin: CSK Antibody [NBP1-85951]
Immunohistochemistry-Paraffin: CSK Antibody [NBP1-85951] - Staining of human duodenum shows weak to moderate cytoplasmic positivity in lymphoid cells.![Immunohistochemistry-Paraffin: CSK Antibody [NBP1-85951]](https://resources.rndsystems.com/images/products/CSK-Antibody-Immunohistochemistry-Paraffin-NBP1-85951-img0012.jpg "Immunohistochemistry-Paraffin: CSK Antibody [NBP1-85951]")
Immunohistochemistry-Paraffin: CSK Antibody [NBP1-85951]
Immunohistochemistry-Paraffin: CSK Antibody [NBP1-85951] - Staining of human cerebellum shows weak to moderate cytoplasmic positivity in Purkinje cells and cells in granular layer.![CSK Antibody - BSA Free Immunohistochemistry-Paraffin: CSK Antibody - BSA Free [NBP1-85951]](https://resources.rndsystems.com/images/products/nbp1-85951_rabbit-polyclonal-csk-antibody-2342025151050.jpg "Immunohistochemistry-Paraffin: CSK Antibody - BSA Free [NBP1-85951]")
Immunohistochemistry-Paraffin: CSK Antibody - BSA Free [NBP1-85951]
Staining of human lymph node shows weak to moderate cytoplasmic positivity in germinal center cells.![CSK Antibody - BSA Free Immunohistochemistry-Paraffin: CSK Antibody - BSA Free [NBP1-85951]](https://resources.rndsystems.com/images/products/nbp1-85951_rabbit-polyclonal-csk-antibody-23420251584470.jpg "Immunohistochemistry-Paraffin: CSK Antibody - BSA Free [NBP1-85951]")
Immunohistochemistry-Paraffin: CSK Antibody - BSA Free [NBP1-85951]
Staining of human skeletal muscle shows no positivity in myocytes as expected.Applications for CSK Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:1000 - 1:2500
Immunohistochemistry-Paraffin
1:1000 - 1:2500
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: CSK
Long Name
Tyrosine-protein kinase CSK
Alternate Names
C-Src kinase
Gene Symbol
CSK
Additional CSK Products
Product Documents for CSK Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for CSK Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for CSK Antibody - BSA Free
Powered by Bioz
Customer Reviews for CSK Antibody - BSA Free
There are currently no reviews for this product. Be the first to review CSK Antibody - BSA Free and earn rewards!
Have you used CSK Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...