CTGF/CCN2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-86571
![Immunocytochemistry/ Immunofluorescence: CTGF/CCN2 Antibody [NBP1-86571]](https://resources.rndsystems.com/images/products/CTGF-CCN2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86571-img0007.jpg "Immunocytochemistry/ Immunofluorescence: CTGF/CCN2 Antibody [NBP1-86571]")
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Predicted:
Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMG
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
Novus Biologicals Rabbit CTGF/CCN2 Antibody - BSA Free (NBP1-86571) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for CTGF/CCN2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: CTGF/CCN2 Antibody [NBP1-86571]
Immunocytochemistry/Immunofluorescence: CTGF/CCN2 Antibody [NBP1-86571] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus. Antibody staining is shown in green.![Immunohistochemistry-Paraffin: CTGF/CCN2 Antibody [NBP1-86571]](https://resources.rndsystems.com/images/products/CTGF-CCN2-Antibody-Immunohistochemistry-Paraffin-NBP1-86571-img0010.jpg "Immunohistochemistry-Paraffin: CTGF/CCN2 Antibody [NBP1-86571]")
Immunohistochemistry-Paraffin: CTGF/CCN2 Antibody [NBP1-86571]
Immunohistochemistry-Paraffin: CTGF/CCN2 Antibody [NBP1-86571] - Staining of human endometrium shows moderate to strong secreted positivity.![Immunohistochemistry-Paraffin: CTGF/CCN2 Antibody [NBP1-86571]](https://resources.rndsystems.com/images/products/CTGF-CCN2-Antibody-Immunohistochemistry-Paraffin-NBP1-86571-img0008.jpg "Immunohistochemistry-Paraffin: CTGF/CCN2 Antibody [NBP1-86571]")
Immunohistochemistry-Paraffin: CTGF/CCN2 Antibody [NBP1-86571]
Immunohistochemistry-Paraffin: CTGF/CCN2 Antibody [NBP1-86571] - Staining of human placenta shows moderate to strong cytoplasmic positivity in vascular endothelial cells.![Immunohistochemistry-Paraffin: CTGF/CCN2 Antibody [NBP1-86571]](https://resources.rndsystems.com/images/products/CTGF-CCN2-Antibody-Immunohistochemistry-Paraffin-NBP1-86571-img0009.jpg "Immunohistochemistry-Paraffin: CTGF/CCN2 Antibody [NBP1-86571]")
Immunohistochemistry-Paraffin: CTGF/CCN2 Antibody [NBP1-86571]
Immunohistochemistry-Paraffin: CTGF/CCN2 Antibody [NBP1-86571] - Staining of human prostate shows moderate to strong cytoplasmic positivity in smooth muscle cells.![Immunohistochemistry-Paraffin: CTGF/CCN2 Antibody [NBP1-86571]](https://resources.rndsystems.com/images/products/CTGF-CCN2-Antibody-Immunohistochemistry-Paraffin-NBP1-86571-img0011.jpg "Immunohistochemistry-Paraffin: CTGF/CCN2 Antibody [NBP1-86571]")
Immunohistochemistry-Paraffin: CTGF/CCN2 Antibody [NBP1-86571]
Immunohistochemistry-Paraffin: CTGF/CCN2 Antibody [NBP1-86571] - Staining of human skeletal muscle shows weak to moderate cytoplasmic positivity in myocytes.![CTGF/CCN2 Antibody - BSA Free Western Blot: CTGF/CCN2 Antibody - BSA Free [NBP1-86571]](https://resources.rndsystems.com/images/products/nbp1-86571_rabbit-polyclonal-ctgf-ccn2-antibody-30420251343637.jpg "Western Blot: CTGF/CCN2 Antibody - BSA Free [NBP1-86571]")
Western Blot: CTGF/CCN2 Antibody - BSA Free [NBP1-86571]
Analysis in human cell line EFO-21.Applications for CTGF/CCN2 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:20 - 1:50
Immunohistochemistry-Paraffin
1:10-1:20
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: CTGF/CCN2
CTGF antibodies are useful tools for angiogenesis and cell structure research, and for studies on certian types of cancer.
Long Name
Connective Tissue Growth Factor
Alternate Names
CCN2, CTGRP, Fisp12, HCS24, IGFBP-8, NOV2
Gene Symbol
CCN2
Additional CTGF/CCN2 Products
Product Documents for CTGF/CCN2 Antibody - BSA Free
Product Specific Notices for CTGF/CCN2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for CTGF/CCN2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review CTGF/CCN2 Antibody - BSA Free and earn rewards!
Have you used CTGF/CCN2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for CTGF/CCN2 Antibody - BSA Free
Showing
1
-
1 of
1 FAQ
Showing All
-
Q: We are looking for a pair of mouse CTGF antibody for ELISA, we prefer no azide and/or glycerol, and in carrier free form (no EDTA, no Tris, no BSA). For the validation, we need approximately 100ug. If it works, we'll order more later.
A: Unfortunately we do not carry any CTGF antibodies that suit your specifications. We do carry AbSelect antibody purification kits that will remove BSA, Tris and azide from antibody formulations which may be an option for you.
Loading...