CTHRC1 (Collagen triple helix repeat-containing protein 1) is a 28-30 kDa, secreted glycoprotein that bears similarity to the C1q/TNFalpha-related family of proteins. It is expressed by disparate cell types, including renal epithelium, neurons, osteoblasts, and smooth muscle cells. Functionally, it is recognized to be induced by BMP-2 and to block TGF beta-induced collagen type I and III synthesis. Mouse CTHRC1 is 245 amino acids in length. It contains a 32 amino acid (aa) signal sequence, a 16 aa prosegment (aa 33-48), and a 197 aa mature region that shows one collagen-like domain (aa 59-92). Proteolytic processing may generate multiple CTHRC1 isoforms. There is the potential for an intracellular full-length 33 kDa, 245 aa form, plus extracellular isoforms that are 28 kDa (aa 33-245), 26 kDa (aa 49-245), 20 kDa (aa 98-245) and 18 kDa and 16 kDa in size, the last two representing variants of the 20 kDa form with C-terminal processing. CTHRC1 may undergo dimerization, trimerization and oligomerization. One mouse splice variant shows a deletion of aa 53-126. Full-length mouse CTHRC1 shares 99% and 93% aa sequence identity with rat and human CTHRC1, respectively.
CTHRC1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-31797
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Predicted:
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: AIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRI
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for CTHRC1 Antibody - BSA Free
Immunohistochemistry-Paraffin: CTHRC1 Antibody [NBP2-31797]
Immunohistochemistry-Paraffin: CTHRC1 Antibody [NBP2-31797] - Staining of human pancreas shows low positivity in glandular cells as expected.Immunohistochemistry-Paraffin: CTHRC1 Antibody [NBP2-31797]
Immunohistochemistry-Paraffin: CTHRC1 Antibody [NBP2-31797] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.Immunohistochemistry-Paraffin: CTHRC1 Antibody [NBP2-31797]
Immunohistochemistry-Paraffin: CTHRC1 Antibody [NBP2-31797] - Staining of human urinary bladder shows moderate cytoplasmic positivity in urothelial cells.Immunohistochemistry-Paraffin: CTHRC1 Antibody [NBP2-31797]
Immunohistochemistry-Paraffin: CTHRC1 Antibody [NBP2-31797] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.Applications for CTHRC1 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: CTHRC1
Long Name
Collagen Triple Helix Repeat Containing 1
Alternate Names
NMTC1
Gene Symbol
CTHRC1
UniProt
Additional CTHRC1 Products
Product Documents for CTHRC1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for CTHRC1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for CTHRC1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review CTHRC1 Antibody - BSA Free and earn rewards!
Have you used CTHRC1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...