CXCL8/IL-8 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP2-33819PEP

Novus Biologicals
Loading...

Key Product Details

Source

E. coli

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL8.

Source: E. coli

Amino Acid Sequence: SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33819.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP2-33819PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: IL-8/CXCL8

IL8 is a member of the CXC chemokine family. This family of small basic heparan-binding proteins are proinflammatory and primarily mediate the activation and migration of neutrophils into tissue from peripheral blood. This chemokine is one of the major mediators of the inflammatory response and is secreted by several cell types in response to an inflammatory stimulus. It functions as a chemoattractant, and is also a potent angiogenic factor. IL8 attracts neutrophils, basophils, and T-cells, but not monocytes. Cystic fibrosis (CF) is characterized by severe lung inflammation. The inflammatory process is believed to be caused by massive overproduction of the proinflammatory protein IL8, and the high levels of IL8 in the CF lung are therefore believed to be the central mechanism behind CF lung pathophysiology.

Long Name

Interleukin 8

Alternate Names

CXCL8, GCP1, IL8, LAI, LECT, LUCT, LYNAP, MDNCF, MONAP, NAF, NAP1, NCF, TCF, TSG1

Gene Symbol

CXCL8

Additional IL-8/CXCL8 Products

Product Documents for CXCL8/IL-8 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CXCL8/IL-8 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for CXCL8/IL-8 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review CXCL8/IL-8 Recombinant Protein Antigen and earn rewards!

Have you used CXCL8/IL-8 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for CXCL8/IL-8 Recombinant Protein Antigen

Showing  1 - 1 of 1 FAQ Showing All
  • Q: Are mouse or rat CXCL8/IL-8 products offered?

    A: Mouse and rat do not have a gene which encodes CXCL8/IL-8. In mouse, the functional homologs to human CXCL8/IL-8 are CXCL1/KC and CXCL2/MIP-2. In rat, the functional homolog to CXCL8/human IL-8 is CXCL3/CINC-2.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Proteins and Enzymes