Ubiquitin carboxyl-terminal hydrolase CYLD (CYLD) is a 956 amino acid (aa) member of the peptidase C67 protein family with a predicted molecular weight of 107 kDa. The mouse and rat CYLD orthologs share 95% and 94% aa sequence identity with the human protein, respectively. Two isoforms of CYLD have been identified, a full-length isoform and a second isoform that lacks aa 305-307 due to alternative splicing. Expression of CYLD has been reported in fetal brain as well as adult brain, heart, leukocytes, skeletal muscle, spleen, and testis. CYLD acts as a deubiquitinase and removes K63-linked Ubiquitin chains from multiple substrates including IkB, c-Jun, and c-Fos, resulting in the inhibition of NFkB and JNK signaling. In some contexts, CYLD enhances mitosis entry, and it has also been shown to delay G 1 /S phase entry suggesting that CYLD regulates multiple phases of the cell cycle. CYLD is recognized as a tumor suppressor and mutations in CYLD result in skin appendage syndromes including Brooke-Spiegle Syndrome, familial cylindromatosis, and familial trichoepitheliomas type 1.
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 654-953 of human CYLD (NP_001035877.1). TKIMKLRKILEKVEAASGFTSEEKDPEEFLNILFHHILRVEPLLKIRSAGQKVQDCYFYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECYDDPDISAGKIKQFCKTCNTQVHLHPKRLNHKYNPVSLPKDLPDWDWRHGCIPCQNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
107 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for CYLD Antibody - BSA Free
Western Blot: CYLD AntibodyBSA Free [NBP2-92436]
Western Blot: CYLD Antibody [NBP2-92436] - Western blot analysis of extracts of various cell lines, using CYLD antibody (NBP2-92436) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.Immunohistochemistry-Paraffin: CYLD Antibody - BSA Free [NBP2-92436]
Immunohistochemistry-Paraffin: CYLD Antibody [NBP2-92436] - Immunohistochemistry of paraffin-embedded mouse spleen using CYLD Rabbit pAb (NBP2-92436) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.Immunohistochemistry-Paraffin: CYLD Antibody - BSA Free [NBP2-92436]
Immunohistochemistry-Paraffin: CYLD Antibody [NBP2-92436] - Immunohistochemistry of paraffin-embedded rat brain using CYLD Rabbit pAb (NBP2-92436) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.Immunohistochemistry-Paraffin: CYLD Antibody - BSA Free [NBP2-92436]
Immunohistochemistry-Paraffin: CYLD Antibody [NBP2-92436] - Immunohistochemistry of paraffin-embedded rat spleen using CYLD Rabbit pAb (NBP2-92436) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.Immunohistochemistry-Paraffin: CYLD Antibody - BSA Free [NBP2-92436]
Immunohistochemistry-Paraffin: CYLD Antibody [NBP2-92436] - Immunohistochemistry of paraffin-embedded human lung cancer using CYLD Rabbit pAb (NBP2-92436) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.Immunohistochemistry-Paraffin: CYLD Antibody - BSA Free [NBP2-92436]
Immunohistochemistry-Paraffin: CYLD Antibody [NBP2-92436] - Immunohistochemistry of paraffin-embedded human esophageal cancer using CYLD Rabbit pAb (NBP2-92436) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.Applications for CYLD Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:50 - 1:200
Western Blot
1:100 - 1:500
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: CYLD
Long Name
Cylindromatosis
Alternate Names
BRSS, CDMT, CYLD1, EAC, MFT1, SBS, TEM, USPL2
Gene Symbol
CYLD
Additional CYLD Products
Product Documents for CYLD Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for CYLD Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for CYLD Antibody - BSA Free
There are currently no reviews for this product. Be the first to review CYLD Antibody - BSA Free and earn rewards!
Have you used CYLD Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...