Cystatin E/M/CST6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33433

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Cystatin E/M Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: SNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKH

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Cystatin E/M/CST6 Antibody - BSA Free

Immunohistochemistry-Paraffin: Cystatin E/M/CST6 Antibody [NBP2-33433]

Immunohistochemistry-Paraffin: Cystatin E/M/CST6 Antibody [NBP2-33433]

Immunohistochemistry-Paraffin: Cystatin E/M/CST6 Antibody [NBP2-33433] - Staining of human skin shows high expression.
Immunohistochemistry-Paraffin: Cystatin E/M/CST6 Antibody [NBP2-33433]

Immunohistochemistry-Paraffin: Cystatin E/M/CST6 Antibody [NBP2-33433]

Immunohistochemistry-Paraffin: Cystatin E/M/CST6 Antibody [NBP2-33433] - Staining of liver cancer.
Immunohistochemistry-Paraffin: Cystatin E/M/CST6 Antibody [NBP2-33433]

Immunohistochemistry-Paraffin: Cystatin E/M/CST6 Antibody [NBP2-33433]

Immunohistochemistry-Paraffin: Cystatin E/M/CST6 Antibody [NBP2-33433] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: Cystatin E/M/CST6 Antibody [NBP2-33433]

Immunohistochemistry-Paraffin: Cystatin E/M/CST6 Antibody [NBP2-33433]

Immunohistochemistry-Paraffin: Cystatin E/M/CST6 Antibody [NBP2-33433] - Staining in human skin and skeletal muscle tissues using anti-CST6 antibody. Corresponding CST6 RNA-seq data are presented for the same tissues.

Applications for Cystatin E/M/CST6 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cystatin E/M

The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. This gene encodes a cystatin from the type 2 family, which is down-regulated in metastatic breast tumor cells as compared to primary tumor cells. Loss of expression is likely associated with the progression of a primary tumor to a metastatic phenotype.

Alternate Names

CST6

Gene Symbol

CST6

UniProt

Q15828

Additional Cystatin E/M Products

Product Documents for Cystatin E/M/CST6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Cystatin E/M/CST6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cysteine Proteases and Regulators

Customer Reviews for Cystatin E/M/CST6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Cystatin E/M/CST6 Antibody - BSA Free and earn rewards!

Have you used Cystatin E/M/CST6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies