Cytokeratin 71 Antibody (1D4) - Azide and BSA Free

Novus Biologicals | Catalog # H00112802-M02

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 1D4

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

KRT71 (NP_258259.1, 251 a.a. ~ 332 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LQAKVESMDQEIKFFRCLFEAEITQIQSHISDMSVILSMDNNRNLDLDSIIDEVRTQYEEIALKSKAEAEALYQTKFQELQL

Specificity

Reacts with keratin 71.

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for Cytokeratin 71 Antibody (1D4) - Azide and BSA Free

Western Blot: Cytokeratin 71 Antibody (1D4) [H00112802-M02]

Western Blot: Cytokeratin 71 Antibody (1D4) [H00112802-M02]

Western Blot: Cytokeratin 71 Antibody (1D4) [H00112802-M02] - Analysis of KRT71 expression in transfected 293T cell line by KRT71 monoclonal antibody (M02), clone 1D4.Lane 1: KRT71 transfected lysate (Predicted MW: 57.2 KDa).Lane 2: Non-transfected lysate.
Sandwich ELISA: Cytokeratin 71 Antibody (1D4) [H00112802-M02] - Detection limit for recombinant GST tagged KRT71 is 0.1 ng/ml as a capture antibody.

Applications for Cytokeratin 71 Antibody (1D4) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
This antibody is reactive against recombinant protein in western blot and ELISA.

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Cytokeratin 71

Keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into epithelial keratins and hair keratins. This gene encodes a protein that is expressed in the inner root sheath of hair follicles. The type II keratins are clustered in a region of chromosome 12q13.

Alternate Names

CK-71, Cytokeratin-71, hK6irs, hK6irs1, K6IRS1MGC119390, K71, KB34, Keratin 6 irs, keratin 71, keratin, type II cytoskeletal 71, Keratin-71, KRT6IRS, KRT6IRS1MGC119391, Type II inner root sheath-specific keratin-K6irs1, Type-II keratin Kb34

Entrez Gene IDs

112802 (Human)

Gene Symbol

KRT71

Additional Cytokeratin 71 Products

Product Documents for Cytokeratin 71 Antibody (1D4) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Cytokeratin 71 Antibody (1D4) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Cytokeratin 71 Antibody (1D4) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Cytokeratin 71 Antibody (1D4) - Azide and BSA Free and earn rewards!

Have you used Cytokeratin 71 Antibody (1D4) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...