Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54827

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to SULT2B1(sulfotransferase family, cytosolic, 2B, member 1) The peptide sequence was selected from the middle region of SULT2B1. Peptide sequence YSKIAGQLKDPGTPDQFLRDFLKGEVQFGSWFDHIKGWLRMKGKDNFLFI. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody - BSA Free

Western Blot: Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody [NBP1-54827]

Western Blot: Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody [NBP1-54827]

Western Blot: Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody [NBP1-54827] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.

Applications for Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cytosolic Sulfotransferase 2B1/SULT2B1

Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene sulfates dehydroepiandrosterone but not 4-nitrophenol, a typical substrate for the phenol and estrogen sulfotransferase subfamilies.Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene sulfates dehydroepiandrosterone but not 4-nitrophenol, a typical substrate for the phenol and estrogen sulfotransferase subfamilies. Two alternatively spliced variants that encode different isoforms have been described.

Alternate Names

HSST2, SULT2B1

Gene Symbol

SULT2B1

Additional Cytosolic Sulfotransferase 2B1/SULT2B1 Products

Product Documents for Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody - BSA Free and earn rewards!

Have you used Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...