DAP12 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85313

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DAP12 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: FLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit DAP12 Antibody - BSA Free (NBP1-85313) is a polyclonal antibody validated for use in IHC and WB. Anti-DAP12 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for DAP12 Antibody - BSA Free

Immunohistochemistry-Paraffin: DAP12 Antibody [NBP1-85313]

Immunohistochemistry-Paraffin: DAP12 Antibody [NBP1-85313]

Immunohistochemistry-Paraffin: DAP12 Antibody [NBP1-85313] - Analysis in human bone marrow and skeletal muscle tissues using NBP1-85313 antibody. Corresponding TYROBP RNA-seq data are presented for the same tissues.
Western Blot: DAP12 Antibody [NBP1-85313]

Western Blot: DAP12 Antibody [NBP1-85313]

Western Blot: DAP12 Antibody [NBP1-85313] - Analysis in control (vector only transfected HEK293T lysate) and TYROBP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: DAP12 Antibody [NBP1-85313]

Immunohistochemistry-Paraffin: DAP12 Antibody [NBP1-85313]

Immunohistochemistry-Paraffin: DAP12 Antibody [NBP1-85313] - Staining of human small intestine shows strong cytoplasmic positivity in goblet cells.
Immunohistochemistry-Paraffin: DAP12 Antibody [NBP1-85313]

Immunohistochemistry-Paraffin: DAP12 Antibody [NBP1-85313]

Immunohistochemistry-Paraffin: DAP12 Antibody [NBP1-85313] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: DAP12 Antibody [NBP1-85313]

Immunohistochemistry-Paraffin: DAP12 Antibody [NBP1-85313]

Immunohistochemistry-Paraffin: DAP12 Antibody [NBP1-85313] - Staining of human bone marrrow shows moderate cytoplasmic positivity in hematopoietic cells.
Immunohistochemistry-Paraffin: DAP12 Antibody [NBP1-85313]

Immunohistochemistry-Paraffin: DAP12 Antibody [NBP1-85313]

Immunohistochemistry-Paraffin: DAP12 Antibody [NBP1-85313] - Staining of human lymph node shows moderate cytoplasmic positivity in non-germinal center cells.

Applications for DAP12 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DAP12

DAP12 is a transmembrane adaptor protein that is non-covalently associated with several cell surface receptors on natural killer (NK), myeloid, and presumably neuronal cells. DAP12 contains an ITAM domain that preferentially recruits the protein tyrosine kinase Syk to initiate signal transduction. Deficiency of DAP12 results in reduced antigen presentation function by myeloid cells and defects in function of certain NK cell receptors in mice, as well as presenile dementia and bone cysts in humans.

Long Name

DNAX-activation Protein 12

Alternate Names

KARAP, TYROBP

Gene Symbol

TYROBP

Additional DAP12 Products

Product Documents for DAP12 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DAP12 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for DAP12 Antibody - BSA Free

Customer Reviews for DAP12 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DAP12 Antibody - BSA Free and earn rewards!

Have you used DAP12 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies